PDB entry 1yb3

View 1yb3 on RCSB PDB site
Description: Conserved hypothetical protein Pfu-178653-001 from Pyrococcus furiosus
Class: structural genomics, unknown function
Keywords: Structural Genomics, Protein Structure Initiative, PSI, conserved hypothetical protein, Pyrococcus furiosus, hyperthermophile, SECSG, The Southeast Collaboratory for Structural Genomics, UNKNOWN FUNCTION
Deposited on 2004-12-19, released 2005-02-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: N/A
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein
    Species: Pyrococcus furiosus [TaxId:2261]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8U4C0 (9-174)
      • modified residue (9)
      • modified residue (60)
      • modified residue (143)
    Domains in SCOPe 2.08: d1yb3a1
  • Heterogens: UNX, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1yb3A (A:)
ahhhhhhgsmlkevhellnriwgdifelreelkeelkgftveevsevfnaylyidgkwee
mkyphpafavkpggevgatpqgfyfvfafpkeelskefiedvirafeklfiygaenfled
fynfehpisgdevwdrivnsdeeminfevdlgfdkeevkreikrfielarrynll

    Sequence, based on observed residues (ATOM records): (download) 
    >1yb3A (A:)
mlkevhellnriwgdifelreelkeelkgftveevsevfnaylyidgkweemkyphpafa
vkpggevgatpqgfyfvfafpkeelskefiedvirafeklfiygaenfledfynfehpis
gdevwdrivnsdeeminfevdlgfdkeevkreikrfielarrynll