PDB entry 1yb1

View 1yb1 on RCSB PDB site
Description: Crystal structure of human 17-beta-hydroxysteroid dehydrogenase type XI
Class: oxidoreductase
Keywords: SHORT CHAIN DEHYDROGENASE, HYDROXYSTEROID DEHYDROGENASE, HUMAN, STRUCTURAL GENOMICS, STRUCTURAL GENOMICS Consortium, SGC
Deposited on 2004-12-18, released 2004-12-28
The last revision prior to the SCOP 1.73 freeze date was dated 2004-12-28, with a file datestamp of 2007-06-28.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: 0.163
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 17-beta-hydroxysteroid dehydrogenase type XI
    Species: HOMO SAPIENS
    Gene: DHRS8
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1yb1a_
  • Chain 'B':
    Compound: 17-beta-hydroxysteroid dehydrogenase type XI
    Species: HOMO SAPIENS
    Gene: DHRS8
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1yb1b_
  • Heterogens: CL, SO4, AE2, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yb1A (A:)
    gsshhhhhhssgrenlyfqghmpkrrksvtgeivlitgaghgigrltayefaklksklvl
    wdinkhgleetaakckglgakvhtfvvdcsnrediyssakkvkaeigdvsilvnnagvvy
    tsdlfatqdpqiektfevnvlahfwttkaflpamtknnhghivtvasaaghvsvpfllay
    csskfaavgfhktltdelaalqitgvkttclcpnfvntgfiknpstslgptlepeevvnr
    lmhgilteqkmifipssiaflttlerilpegs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yb1A (A:)
    rrksvtgeivlitgaghgigrltayefaklksklvlwdinkhgleetaakckglgakvht
    fvvdcsnrediyssakkvkaeigdvsilvnnagvvytsdlfatqdpqiektfevnvlahf
    wttkaflpamtknnhghivtvasaahvsvpfllaycsskfaavgfhktltdelaalqitg
    vkttclcpnfvntgfiknpstslgptlepeevvnrlmhgilteqkmifipssiaflttle
    ril
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yb1B (B:)
    gsshhhhhhssgrenlyfqghmpkrrksvtgeivlitgaghgigrltayefaklksklvl
    wdinkhgleetaakckglgakvhtfvvdcsnrediyssakkvkaeigdvsilvnnagvvy
    tsdlfatqdpqiektfevnvlahfwttkaflpamtknnhghivtvasaaghvsvpfllay
    csskfaavgfhktltdelaalqitgvkttclcpnfvntgfiknpstslgptlepeevvnr
    lmhgilteqkmifipssiaflttlerilpegs
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yb1B (B:)
    rrksvtgeivlitgaghgigrltayefaklksklvlwdinkhgleetaakckglgakvht
    fvvdcsnrediyssakkvkaeigdvsilvnnagvvytsdlfatqdpqiektfevnvlahf
    wttkaflpamtknnhghivtvasahvsvpfllaycsskfaavgfhktltdelaalqitgv
    kttclcpnfvntgfiknpstslgptlepeevvnrlmhgilteqkmifipssiaflttler
    il