PDB entry 1yax

View 1yax on RCSB PDB site
Description: Cystal structure Analysis of S.typhimurium PhoQ sensor domain with Calcium
Deposited on 2004-12-17, released 2005-12-27
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.244
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Virulence sensor protein phoQ, sensor domain
    Species: Salmonella typhimurium [TaxId:602]
    Gene: phoQ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14147 (1-146)
      • initiating methionine (0)
      • expression tag (147-152)
  • Chain 'B':
    Compound: Virulence sensor protein phoQ, sensor domain
    Species: Salmonella typhimurium [TaxId:602]
    Gene: phoQ
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Virulence sensor protein phoQ, sensor domain
    Species: Salmonella typhimurium [TaxId:602]
    Gene: phoQ
    Database cross-references and differences (RAF-indexed):
    • Uniprot P14147 (1-146)
      • initiating methionine (0)
      • expression tag (147-152)
  • Chain 'D':
    Compound: Virulence sensor protein phoQ, sensor domain
    Species: Salmonella typhimurium [TaxId:602]
    Gene: phoQ
    Database cross-references and differences (RAF-indexed):
  • Heterogens: CA, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1yaxA (A:)
    mdkttfrllrgesnlfytlakwennkisvelpenldmqsptmtliydetgkllwtqrnip
    wliksiqpewlktngfheietnvdatstllsedhsaqeklkevreddddaemthsvavni
    ypatarmpqltivvvdtipielkrsymhhhhhh
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1yaxB (B:)
    mdkttfrllrgesnlfytlakwennkisvelpenldmqsptmtliydetgkllwtqrnip
    wliksiqpewlktngfheietnvdatstllsedhsaqeklkevreddddaemthsvavni
    ypatarmpqltivvvdtipielkrsymhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >1yaxB (B:)
    dkttfrllrgesnlfytlakwennkisvelptmtliydetgkllwtqrnipwliksiqpe
    wlktngfheietnvdatstllsedhsaqeklkevreddddaemthsvavniypatarmpq
    ltivvvdtipielk
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >1yaxC (C:)
    mdkttfrllrgesnlfytlakwennkisvelpenldmqsptmtliydetgkllwtqrnip
    wliksiqpewlktngfheietnvdatstllsedhsaqeklkevreddddaemthsvavni
    ypatarmpqltivvvdtipielkrsymhhhhhh
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1yaxD (D:)
    mdkttfrllrgesnlfytlakwennkisvelpenldmqsptmtliydetgkllwtqrnip
    wliksiqpewlktngfheietnvdatstllsedhsaqeklkevreddddaemthsvavni
    ypatarmpqltivvvdtipielkrsymhhhhhh
    

    Sequence, based on observed residues (ATOM records):
    >1yaxD (D:)
    dkttfrllrgesnlfytlakwennkisvelptmtliydetgkllwtqrnipwliksiqpe
    wlktngfheietnvdatstllsedhsaqeklkevreddddaemthsvavniypatarmpq
    ltivvvdtipielk