PDB entry 1yaw

View 1yaw on RCSB PDB site
Description: Crystal structure of thiamine monophosphate kinase (thiL) from Aquifex aeolicus
Class: hydrolase
Keywords: thiL, kinase, dimer, phosphate, New York Structural Genomics Research Consortium, NYSGRC, Protein structure initiative, PSI, T1881, PSI, Protein Structure Initiative
Deposited on 2004-12-17, released 2005-01-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2005-01-11, with a file datestamp of 2007-04-25.
Experiment type: XRAY
Resolution: 2.65 Å
R-factor: 0.238
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Thiamine monophosphate kinase
    Species: Aquifex aeolicus
    Database cross-references and differences (RAF-indexed):
    • GB NP_214452 (0-End)
      • modified residue (0)
      • modified residue (168)
      • conflict (175)
      • modified residue (205)
      • modified residue (241)
      • modified residue (278)
    Domains in SCOPe 2.07: d1yawa1, d1yawa2
  • Chain 'B':
    Compound: Thiamine monophosphate kinase
    Species: Aquifex aeolicus
    Database cross-references and differences (RAF-indexed):
    • GB NP_214452 (0-End)
      • modified residue (0)
      • conflict (6)
      • modified residue (168)
      • conflict (175)
      • modified residue (205)
      • modified residue (241)
      • modified residue (278)
    Domains in SCOPe 2.07: d1yawb1, d1yawb2
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yawA (A:)
    mrlkelaefglidlikktleskvigddtapveycskklllttdvlnegvhflrsyipeav
    gwkaisvnvsdviangglpkwalislnlpedlevsyverfyigvkracefykcevvggni
    sksekigisvflvgeterfvgrdgarlgdsvfvsgtlgdsraglelllmekeeyeefela
    liqrhlrptaridyvkhiqkyanasmdisdglvadanhlaqrsgvkieilseklplsnel
    kmycekygknpieyalfggedyqllfthpkerwnpfldmteigrveegegvfvdgkkvep
    kgwkhf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yawA (A:)
    mrlkelglidlikktleskviddtapvskklllttdvlnegvhflrsyipeavgwkaisv
    nvsdviangglpkwalislnlpedlevsyverfyigvkracefykcevvggnisksekig
    isvflvgeterfvgrdgarlgdsvfvsgtlgdsraglelllmekeeyeefelaliqrhlr
    ptaridyvkhiqkyanasmdisdglvadanhlaqrsgvkieilseklplsnelkmyceky
    gknpieyalfggedyqllfthpkerwnpfldmteigrveeggvfvdgkkvep
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yawB (B:)
    mrlkelaefglidlikktleskvigddtapveycskklllttdvlnegvhflrsyipeav
    gwkaisvnvsdviangglpkwalislnlpedlevsyverfyigvkracefykcevvggni
    sksekigisvflvgeterfvgrdgarlgdsvfvsgtlgdsraglelllmekeeyeefela
    liqrhlrptaridyvkhiqkyanasmdisdglvadanhlaqrsgvkieilseklplsnel
    kmycekygknpieyalfggedyqllfthpkerwnpfldmteigrveegegvfvdgkkvep
    kgwkhf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yawB (B:)
    mrlkelaefglidlikktleskviddtapveklllttdvlnegvhflrsyipeavgwkai
    svnvsdviangglpkwalislnlpedlevsyverfyigvkracefykcevvggnisksek
    igisvflvgeterfvgrdgarlgdsvfvsgtlgdsraglelllmekeeyeefelaliqrh
    lrptaridyvkhiqkyanasmdisdglvadanhlaqrsgvkieilseklplsnelkmyce
    kygknpieyalfggedyqllfthpkerwnpfldmteigrveegegvfvdgkkvep