PDB entry 1yat

View 1yat on RCSB PDB site
Description: improved calcineurin inhibition by yeast fkbp12-drug complexes. crystallographic and functional analysis
Deposited on 1993-01-06, released 1993-10-31
The last revision prior to the SCOP 1.55 freeze date was dated 1993-10-31, with a file datestamp of 1994-01-31.
Experiment type: -
Resolution: 2.5 Å
R-factor: 0.177
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d1yat__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yat_ (-)
    seviegnvkidrispgdgatfpktgdlvtihytgtlengqkfdssvdrgspfqcnigvgq
    vikgwdvgipklsvgekarltipgpyaygprgfpglippnstlvfdvellkvn