PDB entry 1yat

View 1yat on RCSB PDB site
Description: improved calcineurin inhibition by yeast fkbp12-drug complexes. crystallographic and functional analysis
Class: binding protein
Keywords: binding protein
Deposited on 1993-01-06, released 1993-10-31
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: N/A
AEROSPACI score: 0.2 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: fk506 binding protein
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yata_
  • Heterogens: FK5, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yatA (A:)
    seviegnvkidrispgdgatfpktgdlvtihytgtlengqkfdssvdrgspfqcnigvgq
    vikgwdvgipklsvgekarltipgpyaygprgfpglippnstlvfdvellkvn