PDB entry 1yas

View 1yas on RCSB PDB site
Description: hydroxynitrile lyase complexed with histidine
Deposited on 1996-05-15, released 1997-06-16
The last revision prior to the SCOP 1.69 freeze date was dated 2004-06-29, with a file datestamp of 2004-06-29.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.199
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.69: d1yasa_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yasA (A:)
    mafahfvlihtichgawiwhklkpllealghkvtaldlaasgvdprqieeigsfdeysep
    lltflealppgekvilvgescgglniaiaadkycekiaaavfhnsvlpdtehcpsyvvdk
    lmevfpdwkdttyftytkdgkeitglklgftllrenlytlcgpeeyelakmltrkgslfq
    nilakrpfftkegygsikkiyvwtdqdeiflpefqlwqienykpdkvykveggdhklqlt
    ktkeiaeilqevadtyn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yasA (A:)
    afahfvlihtichgawiwhklkpllealghkvtaldlaasgvdprqieeigsfdeysepl
    ltflealppgekvilvgescgglniaiaadkycekiaaavfhnsvlpdtehcpsyvvdkl
    mevfpdwkdttyftytkdgkeitglklgftllrenlytlcgpeeyelakmltrkgslfqn
    ilakrpfftkegygsikkiyvwtdqdeiflpefqlwqienykpdkvykveggdhklqltk
    tkeiaeilqevadtyn