PDB entry 1yaq

View 1yaq on RCSB PDB site
Description: contribution of hydrophobic residues to the stability of human lysozyme: calorimetric studies and x-ray structural analysis of the five isoleucine to valine mutants
Class: hydrolase
Keywords: hydrolase
Deposited on 1995-09-29, released 1996-04-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.164
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: Homo sapiens [TaxId:9606]
    Gene: HUMAN LYSOZYME WITH ILE 89
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61626 (0-129)
      • engineered (88)
    Domains in SCOPe 2.06: d1yaqa_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yaqA (A:)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdnvadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv