PDB entry 1yao

View 1yao on RCSB PDB site
Description:
Deposited on 1995-09-29, released 1996-04-03
The last revision prior to the SCOP 1.63 freeze date was dated 1996-04-03, with a file datestamp of 1996-04-03.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.16
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Compound:
    Species:
    Gene:
    Domains in SCOP 1.63: d1yao__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yao_ (-)
    kvfercelartlkrlgmdgyrgislanwmclakwesgyntratnynagdrstdygvfqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv