PDB entry 1yan

View 1yan on RCSB PDB site
Description: contribution of hydrophobic residues to the stability of human lysozyme: calorimetric studies and x-ray structural analysis of the five isoleucine to valine mutants
Class: hydrolase
Keywords: hydrolase
Deposited on 1995-09-29, released 1996-04-03
The last revision prior to the SCOP 1.75 freeze date was dated 2003-04-01, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.158
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: lysozyme
    Species: HOMO SAPIENS
    Gene: HUMAN LYSOZYME WITH ILE 23
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61626 (0-129)
      • engineered (22)
    Domains in SCOP 1.75: d1yana_
  • Heterogens: NA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yanA (A:)
    kvfercelartlkrlgmdgyrgvslanwmclakwesgyntratnynagdrstdygifqin
    srywcndgktpgavnachlscsallqdniadavacakrvvrdpqgirawvawrnrcqnrd
    vrqyvqgcgv