PDB entry 1yak

View 1yak on RCSB PDB site
Description: Complex of Bacillus subtilis TenA with 4-amino-2-methyl-5-hydroxymethylpyrimidine
Class: transcription
Keywords: thiaminase, TRANSCRIPTION
Deposited on 2004-12-17, released 2005-02-22
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.217
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Transcriptional activator tenA
    Species: Bacillus subtilis [TaxId:1423]
    Gene: tenA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yaka_
  • Chain 'B':
    Compound: Transcriptional activator tenA
    Species: Bacillus subtilis [TaxId:1423]
    Gene: tenA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yakb_
  • Chain 'C':
    Compound: Transcriptional activator tenA
    Species: Bacillus subtilis [TaxId:1423]
    Gene: tenA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yakc_
  • Chain 'D':
    Compound: Transcriptional activator tenA
    Species: Bacillus subtilis [TaxId:1423]
    Gene: tenA
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1yakd_
  • Heterogens: HMH, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yakA (A:)
    mgshhhhhhditslykkagsenlyfqgmkfseecrsaaaewwegsfvhpfvqgigdgtlp
    idrfkyyvlqdsyylthfakvqsfgaayakdlyttgrmashaqgtyeaemalhrefaell
    eiseeerkafkpsptaysytshmyrsvlsgnfaeilaallpcywlyyevgekllhcdpgh
    piyqkwigtyggdwfrqqveeqinrfdelaensteevrakmkenfvissyyeyqfwgmay
    rkegwsdsaikeveecgasrhng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yakA (A:)
    kfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfgaay
    akdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyrsvl
    sgnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinrfde
    laensteevrakmkenfvissyyeyqfwgmayrkegwsd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yakB (B:)
    mgshhhhhhditslykkagsenlyfqgmkfseecrsaaaewwegsfvhpfvqgigdgtlp
    idrfkyyvlqdsyylthfakvqsfgaayakdlyttgrmashaqgtyeaemalhrefaell
    eiseeerkafkpsptaysytshmyrsvlsgnfaeilaallpcywlyyevgekllhcdpgh
    piyqkwigtyggdwfrqqveeqinrfdelaensteevrakmkenfvissyyeyqfwgmay
    rkegwsdsaikeveecgasrhng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yakB (B:)
    kfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfgaay
    akdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyrsvl
    sgnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinrfde
    laensteevrakmkenfvissyyeyqfwgmayrkegws
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yakC (C:)
    mgshhhhhhditslykkagsenlyfqgmkfseecrsaaaewwegsfvhpfvqgigdgtlp
    idrfkyyvlqdsyylthfakvqsfgaayakdlyttgrmashaqgtyeaemalhrefaell
    eiseeerkafkpsptaysytshmyrsvlsgnfaeilaallpcywlyyevgekllhcdpgh
    piyqkwigtyggdwfrqqveeqinrfdelaensteevrakmkenfvissyyeyqfwgmay
    rkegwsdsaikeveecgasrhng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yakC (C:)
    fseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfgaaya
    kdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyrsvls
    gnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinrfdel
    aensteevrakmkenfvissyyeyqfwgmayrkegwsdsa
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yakD (D:)
    mgshhhhhhditslykkagsenlyfqgmkfseecrsaaaewwegsfvhpfvqgigdgtlp
    idrfkyyvlqdsyylthfakvqsfgaayakdlyttgrmashaqgtyeaemalhrefaell
    eiseeerkafkpsptaysytshmyrsvlsgnfaeilaallpcywlyyevgekllhcdpgh
    piyqkwigtyggdwfrqqveeqinrfdelaensteevrakmkenfvissyyeyqfwgmay
    rkegwsdsaikeveecgasrhng
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yakD (D:)
    kfseecrsaaaewwegsfvhpfvqgigdgtlpidrfkyyvlqdsyylthfakvqsfgaay
    akdlyttgrmashaqgtyeaemalhrefaelleiseeerkafkpsptaysytshmyrsvl
    sgnfaeilaallpcywlyyevgekllhcdpghpiyqkwigtyggdwfrqqveeqinrfde
    laensteevrakmkenfvissyyeyqfwgmayrkegwsd