PDB entry 1yai

View 1yai on RCSB PDB site
Description: x-ray structure of a bacterial copper,zinc superoxide dismutase
Deposited on 1996-02-03, released 1997-08-20
The last revision prior to the SCOP 1.65 freeze date was dated 1997-08-20, with a file datestamp of 1997-08-20.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.149
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.65: d1yaia_
  • Chain 'B':
    Domains in SCOP 1.65: d1yaib_
  • Chain 'C':
    Domains in SCOP 1.65: d1yaic_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yaiA (A:)
    qdltvkmtdlqtgkpvgtielsqnkygvvftpeladltpgmhgfhihqngscassekdgk
    vvlggaagghydpehtnkhgfpwtddnhkgdlpalfvsanglatnpvlaprltlkelkgh
    aimihaggdnhsdmpkalggggarvacgviq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1yaiB (B:)
    qdltvkmtdlqtgkpvgtielsqnkygvvftpeladltpgmhgfhihqngscassekdgk
    vvlggaagghydpehtnkhgfpwtddnhkgdlpalfvsanglatnpvlaprltlkelkgh
    aimihaggdnhsdmpkalggggarvacgviq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yaiC (C:)
    qdltvkmtdlqtgkpvgtielsqnkygvvftpeladltpgmhgfhihqngscassekdgk
    vvlggaagghydpehtnkhgfpwtddnhkgdlpalfvsanglatnpvlaprltlkelkgh
    aimihaggdnhsdmpkalggggarvacgviq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yaiC (C:)
    dltvkmtdlqtgkpvgtielsqnkygvvftpeladltpgmhgfhihqngscassekdgkv
    vlggaagghydpehtnkhgfpwtddnhkgdlpalfvsanglatnpvlaprltlkelkgha
    imihaggdnhsdmpkalggggarvacgviq