PDB entry 1yad

View 1yad on RCSB PDB site
Description: structure of teni from bacillus subtilis
Deposited on 2004-12-17, released 2005-02-22
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Regulatory protein tenI
    Species: Bacillus subtilis [TaxId:1423]
    Gene: tenI
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Regulatory protein tenI
    Species: Bacillus subtilis [TaxId:1423]
    Gene: tenI
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Regulatory protein tenI
    Species: Bacillus subtilis [TaxId:1423]
    Gene: tenI
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Regulatory protein tenI
    Species: Bacillus subtilis [TaxId:1423]
    Gene: tenI
    Database cross-references and differences (RAF-indexed):
  • Heterogens: SO4, 144, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1yadA (A:)
    hhhhhhssglvprgshmelhaitddskpveelariiitiqnevdfihirersksaadilk
    lldlifeggidkrklvmngrvdialfstihrvqlpsgsfspkqirarfphlhigrsvhsl
    eeavqaekedadyvlfghvfetdckkglegrgvsllsdikqrisipviaiggmtpdrlrd
    vkqagadgiavmsgifssaepleaarrysrklkemryekal
    

    Sequence, based on observed residues (ATOM records):
    >1yadA (A:)
    melhaitddskpveelariiitiqnevdfihirersksaadilklldlifeggidkrklv
    mngrvdialfstihrvqlpsgsfspkqirarfphlhigrsvhsleeavqaekedadyvlf
    ghvfrgvsllsdikqrisipviaiggmtpdrlrdvkqagadgiavmsgifssaepleaar
    rysrklkemr
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1yadB (B:)
    hhhhhhssglvprgshmelhaitddskpveelariiitiqnevdfihirersksaadilk
    lldlifeggidkrklvmngrvdialfstihrvqlpsgsfspkqirarfphlhigrsvhsl
    eeavqaekedadyvlfghvfetdckkglegrgvsllsdikqrisipviaiggmtpdrlrd
    vkqagadgiavmsgifssaepleaarrysrklkemryekal
    

    Sequence, based on observed residues (ATOM records):
    >1yadB (B:)
    melhaitddskpveelariiitiqnevdfihirersksaadilklldlifeggidkrklv
    mngrvdialfstihrvqlpsgsfspkqirarfphlhigrsvhsleeavqaekedadyvlf
    ghvflegrgvsllsdikqrisipviaiggmtpdrlrdvkqagadgiavmsgifssaeple
    aarrysrklkemr
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1yadC (C:)
    hhhhhhssglvprgshmelhaitddskpveelariiitiqnevdfihirersksaadilk
    lldlifeggidkrklvmngrvdialfstihrvqlpsgsfspkqirarfphlhigrsvhsl
    eeavqaekedadyvlfghvfetdckkglegrgvsllsdikqrisipviaiggmtpdrlrd
    vkqagadgiavmsgifssaepleaarrysrklkemryekal
    

    Sequence, based on observed residues (ATOM records):
    >1yadC (C:)
    melhaitddskpveelariiitiqnevdfihirersksaadilklldlifeggidkrklv
    mngrvdialfstihrvqlpsgsfspkqirarfphlhigrsvhsleeavqaekedadyvlf
    ghvfrgvsllsdikqrisipviaiggmtpdrlrdvkqagadgiavmsgifssaepleaar
    rysrklkemr
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1yadD (D:)
    hhhhhhssglvprgshmelhaitddskpveelariiitiqnevdfihirersksaadilk
    lldlifeggidkrklvmngrvdialfstihrvqlpsgsfspkqirarfphlhigrsvhsl
    eeavqaekedadyvlfghvfetdckkglegrgvsllsdikqrisipviaiggmtpdrlrd
    vkqagadgiavmsgifssaepleaarrysrklkemryekal
    

    Sequence, based on observed residues (ATOM records):
    >1yadD (D:)
    melhaitddskpveelariiitiqnevdfihirersksaadilklldlifeggidkrklv
    mngrvdialfstihrvqlpsgsfspkqirarfphlhigrsvhsleeavqaekedadyvlf
    ghvfrgvsllsdikqrisipviaiggmtpdrlrdvkqagadgiavmsgifssaepleaar
    rysrklkemr