PDB entry 1yac

View 1yac on RCSB PDB site
Description: the 1.8 angstrom crystal structure of the ycac gene product from escherichia coli reveals an octameric hydrolase of unknown specificity
Class: unknown bacterial hydrolase
Keywords: unknown bacterial hydrolase, three layer alpha-beta-alpha sandwich topology, entb homolog, cshase homolog
Deposited on 1998-07-29, released 1999-02-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.175
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ycac gene product
    Species: Escherichia coli [TaxId:562]
    Gene: YCAC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21367
      • conflict (59)
      • conflict (78)
      • conflict (154)
      • conflict (180)
    Domains in SCOPe 2.07: d1yaca_
  • Chain 'B':
    Compound: ycac gene product
    Species: Escherichia coli [TaxId:562]
    Gene: YCAC
    Database cross-references and differences (RAF-indexed):
    • Uniprot P21367
      • conflict (59)
      • conflict (78)
      • conflict (154)
      • conflict (180)
    Domains in SCOPe 2.07: d1yacb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yacA (A:)
    mtkpyvrldkndaavllvdhqagllslvrdiepdkfknnvlalgdlakyfnlptilttsa
    etgpngplvpelkaqfpdapyiarpgninawdnedfvkavkatgkkqliiagvvtevcva
    fpalsaieegfdvfvvtdasgtfneitrhsawdrmsqagaqlmtwfgvacelhrdwrndi
    aglatlfsnhipdyrnlmtsydtltkqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yacA (A:)
    tkpyvrldkndaavllvdhqagllslvrdiepdkfknnvlalgdlakyfnlptilttsae
    tgpngplvpelkaqfpdapyiarpgninawdnedfvkavkatgkkqliiagvvtevcvaf
    palsaieegfdvfvvtdasgtfneitrhsawdrmsqagaqlmtwfgvacelhrdwrndia
    glatlfsnhipdyrnlmtsydtlt
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yacB (B:)
    mtkpyvrldkndaavllvdhqagllslvrdiepdkfknnvlalgdlakyfnlptilttsa
    etgpngplvpelkaqfpdapyiarpgninawdnedfvkavkatgkkqliiagvvtevcva
    fpalsaieegfdvfvvtdasgtfneitrhsawdrmsqagaqlmtwfgvacelhrdwrndi
    aglatlfsnhipdyrnlmtsydtltkqk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yacB (B:)
    tkpyvrldkndaavllvdhqagllslvrdiepdkfknnvlalgdlakyfnlptilttsae
    tgpngplvpelkaqfpdapyiarpgninawdnedfvkavkatgkkqliiagvvtevcvaf
    palsaieegfdvfvvtdasgtfneitrhsawdrmsqagaqlmtwfgvacelhrdwrndia
    glatlfsnhipdyrnlmtsydtlt