PDB entry 1ya9

View 1ya9 on RCSB PDB site
Description: crystal structure of the 22kda n-terminal fragment of mouse apolipoprotein e
Deposited on 2004-12-17, released 2005-06-07
The last revision was dated 2019-07-24, with a file datestamp of 2019-07-19.
Experiment type: XRAY
Resolution: 2.09 Å
R-factor: 0.215
AEROSPACI score: 0.4 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: apolipoprotein e
    Species: Mus musculus [TaxId:10090]
    Gene: Apoe
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1ya9A (A:)
    gepevtdqlewqsnqpweqalnrfwdylrwvqtlsdqvqeelqssqvtqeltalmedtmt
    evkaykkeleeqlgpvaeetrarlgkevqaaqarlgadmedlrnrlgqyrnevhtmlgqs
    teeirarlsthlrkmrkrlmrdaedlqkrlavykagaregaergvsairerlgplveqgr
    q
    

    Sequence, based on observed residues (ATOM records):
    >1ya9A (A:)
    pevtdqlewqsnqpweqalnrfwdylrwvqtlsdqvqeelqssqvtqeltalmedtmtev
    kaykkeleeqlgpvaeetrarlgkevqaaqarlgadmedlrnrlgqyrnevhtmlgqste
    eirarlsthlrkmrkrlmrdaedlqkrlavykagagvsairerlgplv