PDB entry 1ya6

View 1ya6 on RCSB PDB site
Description: alpha-glucosyltransferase in complex with UDP and a 13-mer DNA containing a central A:G mismatch
Deposited on 2004-12-17, released 2005-08-30
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.23
AEROSPACI score: 0.3 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA alpha-glucosyltransferase
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04519 (3-402)
      • cloning artifact (2)
  • Chain 'B':
    Compound: DNA alpha-glucosyltransferase
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04519 (3-402)
      • cloning artifact (0-2)
  • Chain 'C':
    Compound: 5'-d(*ap*tp*ap*cp*tp*ap*ap*gp*ap*tp*ap*g)-3'
  • Chain 'D':
    Compound: 5'-d(*cp*tp*ap*tp*cp*tp*gp*ap*gp*tp*ap*t)-3'
  • Heterogens: NCO, UDP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1ya6A (A:)
    mgsmricifmarglegcgvtkfsleqrdwfiknghevtlvyakdksftrtsshdhksfsi
    pvilakeydkalklvndcdiliinsvpatsvqeatinnykklldnikpsirvvvyqhdhs
    vlslrrnlgleetvrradvifshsdngdfnkvlmkewypetvslfddieeaptvynfqpp
    mdivkvrstywkdvseinmninrwigrtttwkgfyqmfdfhekflkpagkstvmeglers
    pafiaikekgipyeyygnreidkmnlapnqpaqildcyinsemlermsksgfgyqlskln
    qkylqrsleythlelgacgtipvfwkstgenlkfrvdntpltshdsgiiwfdendmestf
    erikelssdralydrerekayeflyqhqdssfcfkeqfdiitk
    

    Sequence, based on observed residues (ATOM records):
    >1ya6A (A:)
    smricifmarglegcgvtkfsleqrdwfiknghevtlvyakdksftrtsshdhksfsipv
    ilakeydkalklvndcdiliinsvpatsvqeatinnykklldnikpsirvvvyqhdhsvl
    slrrnlgleetvrradvifshsdngdfnptvynfqppmdivkvrstywkdvseinmninr
    wigrtttwkgfyqmfdfhekflkpagkstvmeglerspafiaikekgipyeyygnreidk
    mnlapnqpaqildcyinsemlermsksgfgyqlsklnqkylqrsleythlelgacgtipv
    fwkstgenlkfrvdntpltshdsgiiwfdendmestferikelssdralydrerekayef
    lyqhqdssfcfkeqfdiitk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1ya6B (B:)
    mgsmricifmarglegcgvtkfsleqrdwfiknghevtlvyakdksftrtsshdhksfsi
    pvilakeydkalklvndcdiliinsvpatsvqeatinnykklldnikpsirvvvyqhdhs
    vlslrrnlgleetvrradvifshsdngdfnkvlmkewypetvslfddieeaptvynfqpp
    mdivkvrstywkdvseinmninrwigrtttwkgfyqmfdfhekflkpagkstvmeglers
    pafiaikekgipyeyygnreidkmnlapnqpaqildcyinsemlermsksgfgyqlskln
    qkylqrsleythlelgacgtipvfwkstgenlkfrvdntpltshdsgiiwfdendmestf
    erikelssdralydrerekayeflyqhqdssfcfkeqfdiitk
    

    Sequence, based on observed residues (ATOM records):
    >1ya6B (B:)
    mgsmricifmarglegcgvtkfsleqrdwfiknghevtlvyakdksftrtsshdhksfsi
    pvilakeydkalklvndcdiliinsvpatsvqeatinnykklldnikpsirvvvyqhdhs
    vlslrrnlgleetvrradvifshsdptvynfqppmdivkvrstywkdvseinmninrwig
    rtttwkgfyqmfdfhekflkpagkstvmeglerspafiaikekgipyeyygnreidkmnl
    apnqpaqildcyinsemlermsksgfgyqlsklnqkylqrsleythlelgacgtipvfwk
    stgenlkfrvdntpltshdsgiiwfdendmestferikelssdralydrerekayeflyq
    hqdssfcfkeqfdiitk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.