PDB entry 1ya5

View 1ya5 on RCSB PDB site
Description: Crystal structure of the titin domains z1z2 in complex with telethonin
Class: structural protein
Keywords: TELETHONIN; T-CAP; Ig-LIKE DOMAINS; Z1; Z2; TITIN, STRUCTURAL PROTEIN
Deposited on 2004-12-17, released 2005-12-20
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.44 Å
R-factor: 0.233
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: N2B-Titin Isoform
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6PJP0 (0-195)
      • cloning artifact (196-197)
    Domains in SCOPe 2.06: d1ya5a1, d1ya5a2, d1ya5a3
  • Chain 'B':
    Compound: N2B-Titin Isoform
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q6PJP0 (0-195)
      • cloning artifact (196)
    Domains in SCOPe 2.06: d1ya5b1, d1ya5b2, d1ya5b3
  • Chain 'T':
    Compound: Telethonin
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot O15273 (0-End)
      • engineered (7)
      • engineered (14)
      • engineered (37)
      • engineered (56)
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ya5A (A:)
    mttqaptftqplqsvvvlegstatfeahisgfpvpevswfrdgqviststlpgvqisfsd
    grakltipavtkansgryslkatngsgqatstaellvkaetappnfvqrlqsmtvrqgsq
    vrlqvrvtgiptpvvkfyrdgaeiqssldfqisqegdlyslliaeaypedsgtysvnatn
    svgratstaellvqgetreef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ya5A (A:)
    mttqaptftqplqsvvvlegstatfeahisgfpvpevswfrdgqviststlpgvqisfsd
    grakltipavtkansgryslkatngsgqatstaellvkaetappnfvqrlqsmtvrqgsq
    vrlqvrvtgiptpvvkfyrdgaeiqssldfqisqegdlyslliaeaypedsgtysvnatn
    svgratstaellvqgetr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ya5B (B:)
    mttqaptftqplqsvvvlegstatfeahisgfpvpevswfrdgqviststlpgvqisfsd
    grakltipavtkansgryslkatngsgqatstaellvkaetappnfvqrlqsmtvrqgsq
    vrlqvrvtgiptpvvkfyrdgaeiqssldfqisqegdlyslliaeaypedsgtysvnatn
    svgratstaellvqgetreef
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ya5B (B:)
    mttqaptftqplqsvvvlegstatfeahisgfpvpevswfrdgqviststlpgvqisfsd
    grakltipavtkansgryslkatngsgqatstaellvkaetappnfvqrlqsmtvrqgsq
    vrlqvrvtgiptpvvkfyrdgaeiqssldfqisqegdlyslliaeaypedsgtysvnatn
    svgratstaellvqget
    

  • Chain 'T':
    No sequence available.