PDB entry 1ya0

View 1ya0 on RCSB PDB site
Description: Crystal structure of the N-terminal domain of human SMG7
Class: signaling protein
Keywords: alpha-helical repeat, tetratricopetide repeat (TPR), 14-3-3
Deposited on 2004-12-17, released 2005-03-15
The last revision prior to the SCOP 1.75 freeze date was dated 2005-03-15, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.55 Å
R-factor: 0.246
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: SMG-7 transcript variant 2
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ya0a1
  • Chain 'B':
    Compound: SMG-7 transcript variant 2
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.75: d1ya0b1
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ya0A (A:)
    mslqsaqylrqaevlkadmtdsklgpaevwtsrqalqdlyqkmlvtdleyaldkkveqdl
    wnhafknqittlqgqaknranpnrsevqanlslfleaasgfytqllqelctvfnvdlpcr
    vkssqlgiisnkqthtsaivkpqssscsyicqhclvhlgdiaryrnqtsqaesyyrhaaq
    lvpsngqpynqlailasskgdhlttifyycrsiavkfpfpaastnlqkalskalesrdev
    ktkwgvsdfikafikfhghvylsksleklsplrekleeqfkellfqkafnsqqlvhvtvi
    nlfqlhhlrdfsneteqhtysqdeqlcwtqllalfmsflgilckcplqnesqeesynayp
    lpavkvsmdwlrlrprvfqeavvderqyiwpwlisllnsfhpheedlssisatplpeefe
    lqgflalrpsfrnldfskghqgitgdkegqqrrirqqrlisigkwiadnqprliqcenev
    gkllfiteipeliledp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ya0A (A:)
    mslqsaqylrqaevlkadmtdsklgpaevwtsrqalqdlyqkmlvtdleyaldkkveqdl
    wnhafknqittlqgqaknranpnrsevqanlslfleaasgfytqllqelctqssscsyic
    qhclvhlgdiaryrnqtsqaesyyrhaaqlvpsngqpynqlailasskgdhlttifyycr
    siavkfpfpaastnlqkalskalesrdevktkwgvsdfikafikfhghvylsksleklsp
    lrekleeqfkellfqkafnsqqlvhvtvinlfqlhhlrdfsneteqhtysqdeqlcwtql
    lalfmsflgilckcplqnsqeesynayplpavkvsmdwlrlrprvfqeavvderqyiwpw
    lisllnsfhpheedlsisatplpeefelqgflalrpsfrnldfskghkegqqrrirqqrl
    isigkwiadnqprliqcenevgkllfiteipeliledp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1ya0B (B:)
    mslqsaqylrqaevlkadmtdsklgpaevwtsrqalqdlyqkmlvtdleyaldkkveqdl
    wnhafknqittlqgqaknranpnrsevqanlslfleaasgfytqllqelctvfnvdlpcr
    vkssqlgiisnkqthtsaivkpqssscsyicqhclvhlgdiaryrnqtsqaesyyrhaaq
    lvpsngqpynqlailasskgdhlttifyycrsiavkfpfpaastnlqkalskalesrdev
    ktkwgvsdfikafikfhghvylsksleklsplrekleeqfkellfqkafnsqqlvhvtvi
    nlfqlhhlrdfsneteqhtysqdeqlcwtqllalfmsflgilckcplqnesqeesynayp
    lpavkvsmdwlrlrprvfqeavvderqyiwpwlisllnsfhpheedlssisatplpeefe
    lqgflalrpsfrnldfskghqgitgdkegqqrrirqqrlisigkwiadnqprliqcenev
    gkllfiteipeliledp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ya0B (B:)
    mslqsaqylrqaevlkadmtdsklgpaevwtsrqalqdlyqkmlvtdleyaldkkveqdl
    wnhafknqittlqgqaknranpnrsevqanlslfleaasgfytqllqelctvfnvdlpcp
    qssscsyicqhclvhlgdiaryrnqtsqaesyyrhaaqlvpsngqpynqlailasskgdh
    lttifyycrsiavkfpfpaastnlqkalskalesrdevktkwgvsdfikafikfhghvyl
    sksleklsplrekleeqfkellfqkafnsqqlvhvtvinlfqlhhlrdfsneteqhtysq
    deqlcwtqllalfmsflgilckcplqneesynayplpavkvsmdwlrlrprvfqeavvde
    rqyiwpwlisllnsfhpheedlssisatplpeefelqgflalrpsfrnldfskkegqqrr
    irqqrlisigkwiadnqprliqcenevgkllfiteipeliledp