PDB entry 1y9z

View 1y9z on RCSB PDB site
Description: Crystal Structure of Psychrophilic Subtilisin-like Serine Protease from Antarctic Psychrotroph Pseudoalteromonas sp. AS-11 at 0.14 nm resolution
Class: hydrolase
Keywords: subtilisin-like alpha/beta domain, insert beta barrel domain, HYDROLASE
Deposited on 2004-12-16, released 2006-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.197
AEROSPACI score: 0.66 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alkaline serine protease
    Species: Pseudoalteromonas sp. [TaxId:247492]
    Database cross-references and differences (RAF-indexed):
    • GB BAD51450 (0-End)
    Domains in SCOPe 2.07: d1y9za_
  • Chain 'B':
    Compound: Alkaline serine protease
    Species: Pseudoalteromonas sp. [TaxId:247492]
    Database cross-references and differences (RAF-indexed):
    • GB BAD51450 (0-End)
    Domains in SCOPe 2.07: d1y9zb_
  • Heterogens: CA, NA, SO4, PMS, TRS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y9zA (A:)
    aettpwgqtfvgatvlsdsqagnrticiidsgydrshndlnannvtgtnnsgtgnwyqpg
    nnnahgthvagtiaaiannegvvgvmpnqnanihivkvfneagwgyssslvaaidtcvns
    gganvvtmslggsgsttternalnthynngvlliaaagnagdssysypasydsvmsvaav
    dsnldhaafsqytdqveisgpgeailstvtvgegrladitiggqsyfsngvvphnrltps
    gtsyapapinasatgalaectvngtsfscgnmankiclvervgnqgssypeinstkackt
    agakgiivysnsalpglqnpflvdansditvpsvsvdratglalkaklgqsttvsnqgnq
    dyeyyngtsmatphvsgvatlvwsyhpecsasqvraalnataddlsvagrdnqtgygmin
    avaakayldesctgptdpgtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y9zA (A:)
    aettpwgqtfvgatvlsdsqagnrticiidsgydrshndlnannvtgtnnsgtgnwyqpg
    nnnahgthvagtiaaiannegvvgvmpnqnanihivkvfneagwgyssslvaaidtcvns
    gganvvtmslggsgsttternalnthynngvlliaaagnagdssysypasydsvmsvaav
    dsnldhaafsqytdqveisgpgeailstvtvgegrladitiggqsyfsngvvphnrltps
    gtsyapapinasatgalaectvngtsfscgnmankiclvervgnqgssypeinstkackt
    agakgiivysnsalpglqnpflvdansditvpsvsvdratglalkaklgqsttvsnqgnq
    dyeyyngtsmatphvsgvatlvwsyhpecsasqvraalnataddlsvagrdnqtgygmin
    avaakayldesctgp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y9zB (B:)
    aettpwgqtfvgatvlsdsqagnrticiidsgydrshndlnannvtgtnnsgtgnwyqpg
    nnnahgthvagtiaaiannegvvgvmpnqnanihivkvfneagwgyssslvaaidtcvns
    gganvvtmslggsgsttternalnthynngvlliaaagnagdssysypasydsvmsvaav
    dsnldhaafsqytdqveisgpgeailstvtvgegrladitiggqsyfsngvvphnrltps
    gtsyapapinasatgalaectvngtsfscgnmankiclvervgnqgssypeinstkackt
    agakgiivysnsalpglqnpflvdansditvpsvsvdratglalkaklgqsttvsnqgnq
    dyeyyngtsmatphvsgvatlvwsyhpecsasqvraalnataddlsvagrdnqtgygmin
    avaakayldesctgptdpgtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y9zB (B:)
    aettpwgqtfvgatvlsdsqagnrticiidsgydrshndlnannvtgtnnsgtgnwyqpg
    nnnahgthvagtiaaiannegvvgvmpnqnanihivkvfneagwgyssslvaaidtcvns
    gganvvtmslggsgsttternalnthynngvlliaaagnagdssysypasydsvmsvaav
    dsnldhaafsqytdqveisgpgeailstvtvgegrladitiggqsyfsngvvphnrltps
    gtsyapapinasatgalaectvngtsfscgnmankiclvervgnqgssypeinstkackt
    agakgiivysnsalpglqnpflvdansditvpsvsvdratglalkaklgqsttvsnqgnq
    dyeyyngtsmatphvsgvatlvwsyhpecsasqvraalnataddlsvagrdnqtgygmin
    avaakayldesctgpt