PDB entry 1y9x

View 1y9x on RCSB PDB site
Description: Solution structure of Archaeon DNA-binding protein ssh10b
Class: DNA binding protein
Keywords: DNA binding, archaea, DNA binding protein
Deposited on 2004-12-16, released 2005-06-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DNA/RNA-binding protein alba 1
  Species: Sulfolobus shibatae [TaxId:2286]
  Gene: albA1, ssh10b
  Database cross-references and differences (RAF-indexed):
  • Uniprot P60848 (1-96)
    • initiating methionine (0)
    • engineered (61)
  Domains in SCOPe 2.07: d1y9xa_
• Chain 'B':
  Compound: DNA/RNA-binding protein alba 1
  Species: Sulfolobus shibatae [TaxId:2286]
  Gene: albA1, ssh10b
  Database cross-references and differences (RAF-indexed):
  • Uniprot P60848 (1-96)
    • initiating methionine (0)
    • engineered (61)
  Domains in SCOPe 2.07: d1y9xb_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1y9xA (A:)
  mssgtptpsnvvligkkpvmnyvlaaltllnqgvseivikargraiskavdtveivrnrf
  ladkieikeirvgsqvvtsqdgrqsrvstieiairkk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1y9xB (B:)
  mssgtptpsnvvligkkpvmnyvlaaltllnqgvseivikargraiskavdtveivrnrf
  ladkieikeirvgsqvvtsqdgrqsrvstieiairkk