PDB entry 1y9x

View 1y9x on RCSB PDB site
Description: Solution structure of Archaeon DNA-binding protein ssh10b
Class: DNA binding protein
Keywords: DNA binding, archaea, DNA binding protein
Deposited on 2004-12-16, released 2005-06-21
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA/RNA-binding protein alba 1
    Species: Sulfolobus shibatae [TaxId:2286]
    Gene: albA1, ssh10b
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60848 (1-96)
      • initiating methionine (0)
      • engineered (61)
    Domains in SCOPe 2.08: d1y9xa_
  • Chain 'B':
    Compound: DNA/RNA-binding protein alba 1
    Species: Sulfolobus shibatae [TaxId:2286]
    Gene: albA1, ssh10b
    Database cross-references and differences (RAF-indexed):
    • Uniprot P60848 (1-96)
      • initiating methionine (0)
      • engineered (61)
    Domains in SCOPe 2.08: d1y9xb_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y9xA (A:)
    mssgtptpsnvvligkkpvmnyvlaaltllnqgvseivikargraiskavdtveivrnrf
    ladkieikeirvgsqvvtsqdgrqsrvstieiairkk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y9xB (B:)
    mssgtptpsnvvligkkpvmnyvlaaltllnqgvseivikargraiskavdtveivrnrf
    ladkieikeirvgsqvvtsqdgrqsrvstieiairkk