PDB entry 1y9w

View 1y9w on RCSB PDB site
Description: Structural Genomics, 1.9A crystal structure of an acetyltransferase from Bacillus cereus ATCC 14579
Class: transferase
Keywords: Bacillus cereus, acetyltransferase, Structural Genomics, Protein Structure Initiative, PSI, Midwest Center for Structural Genomics, MCSG, TRANSFERASE
Deposited on 2004-12-16, released 2005-02-01
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.202
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Acetyltransferase
    Species: Bacillus cereus [TaxId:226900]
    Gene: gi:29896479
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1y9wa1
  • Chain 'B':
    Compound: Acetyltransferase
    Species: Bacillus cereus [TaxId:226900]
    Gene: gi:29896479
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1y9wb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y9wA (A:)
    mymkhiengtriegeyiknkviqynmsiltdevkqpmeevslvvkneegkifggvtgtmy
    fyhlhidflwvdesvrhdgygsqllheiegiakekgcrlilldsfsfqapefykkhgyre
    ygvvedhpkghsqhffekrl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y9wB (B:)
    mymkhiengtriegeyiknkviqynmsiltdevkqpmeevslvvkneegkifggvtgtmy
    fyhlhidflwvdesvrhdgygsqllheiegiakekgcrlilldsfsfqapefykkhgyre
    ygvvedhpkghsqhffekrl