PDB entry 1y9u

View 1y9u on RCSB PDB site
Description: Bordetella ferric binding protein
Class: metal binding protein
Keywords: periplasmic binding protein, iron tyrosinate interaction, METAL BINDING PROTEIN
Deposited on 2004-12-16, released 2005-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 1.39 Å
R-factor: 0.166
AEROSPACI score: 0.7 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Putative iron binding protein
    Species: Bordetella pertussis Tohama I [TaxId:257313]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y9ua_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y9uA (A:)
    gshmsdevslyttrepkliqplldafakdsgikvntvfvkdgllervraegdkspadvlm
    tvdignlidlvnggvtqkiqsqtldsvvpanlrgaegswyalslrdrvlyvekdlkldsf
    rygdladpkwkgkvcirsgqhpyntalvaamiahdgaeatekwlrgvkanlarkaaggdr
    dvardilggicdiglanayyvghmknaepgtdarkwgdaikvvrptfatakdggthvnis
    gaavaahapnkanavklleylvsepaqtlyaqanyeypvragvkldavvasfgplkvdtl
    pvaeiakyrkqaselvdkvgfdn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y9uA (A:)
    devslyttrepkliqplldafakdsgikvntvfvkdgllervraegdkspadvlmtvdig
    nlidlvnggvtqkiqsqtldsvvpanlrgaegswyalslrdrvlyvekdlkldsfrygdl
    adpkwkgkvcirsgqhpyntalvaamiahdgaeatekwlrgvkanlarkaaggdrdvard
    ilggicdiglanayyvghmknaepgtdarkwgdaikvvrptfaggthvnisgaavaahap
    nkanavklleylvsepaqtlyaqanyeypvragvkldavvasfgplkvdtlpvaeiakyr
    kqaselvdkvgfdn