PDB entry 1y9q

View 1y9q on RCSB PDB site
Description: Crystal Structure of HTH_3 family Transcriptional Regulator from Vibrio cholerae
Class: transcription regulator
Keywords: HTH_3 family, Transcriptional Regulaator, Strucutral Genomics, Protein Structure Initiative, PSI, New York SGX Research Center for Structural Genomics, NYSGXRC, Dimer, Two-domain structure, Structural Genomics, TRANSCRIPTION REGULATOR
Deposited on 2004-12-16, released 2005-01-04
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.199
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: transcriptional regulator, HTH_3 family
    Species: Vibrio cholerae [TaxId:666]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9KQN0 (3-End)
      • modified residue (6)
      • modified residue (39)
      • modified residue (89)
      • modified residue (117)
      • modified residue (136)
    Domains in SCOPe 2.07: d1y9qa1, d1y9qa2
  • Heterogens: ZN, MED, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y9qA (A:)
    msltdvmfksqianqlknlrksrglsldataqltgvskamlgqiergessptiatlwkia
    sgleasfsaffandpqllssersfpddlnmkihtlfpyaadtgleifeitlldhhqqmss
    phalgvieyihvlegimkvffdeqwhelqqgehirffsdqphgyaavtekavfqnivayp
    rreggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y9qA (A:)
    tdvmfksqianqlknlrksrglsldataqltgvskamlgqiergessptiatlwkiasgl
    easfsaffandpqllssersfpddlnmkihtlfpyaadtgleifeitlldhhqqmsspha
    lgvieyihvlegimkvffdeqwhelqqgehirffsdqphgyaavtekavfqnivaypr