PDB entry 1y9o

View 1y9o on RCSB PDB site
Description: 1H NMR Structure of Acylphosphatase from the hyperthermophile Sulfolobus Solfataricus
Class: hydrolase
Keywords: Sso, Acylphosphatase, Hyperthermophile, NMR, HYDROLASE
Deposited on 2004-12-16, released 2005-11-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: acylphosphatase
    Species: Sulfolobus solfataricus [TaxId:2287]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q97ZL0 (2-102)
      • cloning artifact (0-1)
    Domains in SCOPe 2.07: d1y9oa1, d1y9oa2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y9oA (A:)
    gsmkkwsdtevfemlkrmyarvyglvqgvgfrkfvqihairlgikgyaknlpdgsvevva
    egyeealskllerikqgppaaevekvdysfseykgefedfety