PDB entry 1y9m

View 1y9m on RCSB PDB site
Description: Crystal structure of exo-inulinase from Aspergillus awamori in spacegroup P212121
Class: hydrolase
Keywords: Exo-inulinase, Aspergillus awamori, Glycoside hydrolase family 32, Crystallographic structure, native structure, HYDROLASE
Deposited on 2004-12-16, released 2004-12-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.89 Å
R-factor: 0.167
AEROSPACI score: 0.5 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exo-inulinase
    Species: Aspergillus awamori [TaxId:105351]
    Database cross-references and differences (RAF-indexed):
    • GB CAC44220 (0-End)
    Domains in SCOPe 2.06: d1y9ma1, d1y9ma2
  • Heterogens: MAN, NAG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y9mA (A:)
    fnydqpyrgqyhfspqknwmndpngllyhngtyhlffqynpggiewgniswghaisedlt
    hweekpvallargfgsdvtemyfsgsavadvnntsgfgkdgktplvamytsyypvaqtlp
    sgqtvqedqqsqsiayslddgltwttydaanpvipnppspyeaeyqnfrdpfvfwhdesq
    kwvvvtsiaelhklaiytsdnlkdwklvsefgpynaqggvwecpglvklpldsgnstkwv
    itsglnpggppgtvgsgtqyfvgefdgttftpdadtvypgnstanwmdwgpdfyaaagyn
    glslndhvhigwmnnwqyganiptypwrsamaiprhmalktigskatlvqqpqeawssis
    nkrpiysrtfktlsegstnttttgetfkvdlsfsakskastfaialrasanfteqtlvgy
    dfakqqifldrthsgdvsfdetfasvyhgpltpdstgvvklsifvdrssvevfggqgett
    ltaqifpssdavharlastggttedvradiykiastwn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y9mA (A:)
    fnydqpyrgqyhfspqknwmndpngllyhngtyhlffqynpggiewgniswghaisedlt
    hweekpvallargfgsdvtemyfsgsavadvnntsgfgkdgktplvamytsyypvaqtlp
    sgqtvqedqqsqsiayslddgltwttydaanpvipnppspyeaeyqnfrdpfvfwhdesq
    kwvvvtsiaelhklaiytsdnlkdwklvsefgpynaqggvwecpglvklpldsgnstkwv
    itsglnpggppgtvgsgtqyfvgefdgttftpdadtvypgnstanwmdwgpdfyaaagyn
    glslndhvhigwmnnwqyganiptypwrsamaiprhmalktigskatlvqqpqeawssis
    nkrpiysrtfktlsegstnttttgetfkvdlsfsakskastfaialrasanfteqtlvgy
    dfakqqifldrthsgdvsfdetfasvyhgpltpdstgvvklsifvdrssvevfggqgett
    ltaqifpssdavharlastggttedvradiykiastw