PDB entry 1y9l

View 1y9l on RCSB PDB site
Description: The X-ray structure of an secretion system protein
Deposited on 2004-12-15, released 2005-04-12
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.5 Å
R-factor: 0.22
AEROSPACI score: 0.59 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Lipoprotein mxiM
    Species: Shigella flexneri [TaxId:623]
    Gene: mxiM
    Database cross-references and differences (RAF-indexed):
  • Heterogens: ACT, UND, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1y9lA (A:)
    sssnsekewhivpvskdyfsipndllwsfnttnksinvyskcisgkavysfnagkfmgnf
    nvkevdgcfmdaqkiaidklfsmlkdgvvlkgnkindtiliekdgevklklirgi
    

    Sequence, based on observed residues (ATOM records):
    >1y9lA (A:)
    ekewhivpvskdyfsipndllwsfnttnksinvyskcisgkavysfnagkfmgnfnvkev
    dgcfmdaqkiaidklfsmlkdgvvlkgnkindtiliekdgevklklirgi