PDB entry 1y9j

View 1y9j on RCSB PDB site
Description: Solution structure of the rat Sly1 N-terminal domain
Deposited on 2004-12-15, released 2005-02-15
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sec1 family domain containing protein 1
    Species: Rattus norvegicus [TaxId:10116]
    Gene: Scfd1, Ra410, Sly1, Stxbp1l2
    Database cross-references and differences (RAF-indexed):

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1y9jA (A:)
    gspgisgggggilvgskmaasirerqtvalkrmlnfnvphvknspgepvwkvliydrfgq
    diispllsvkelrdmgitlhlllhsdrdpirdvpavyfvmpteenidrlcqdlrnqlyes
    yylnfisaisrskledianaalaanavtqvakvfdqyln
    

    Sequence, based on observed residues (ATOM records):
    >1y9jA (A:)
    asirerqtvalkrmlnfnvphvknspgepvwkvliydrfgqdiispllsvkelrdmgitl
    hlllhsdrdpirdvpavyfvmpteenidrlcqdlrnqlyesyylnfisaisrskledian
    aalaanavtqvakvfdqyln