PDB entry 1y9i

View 1y9i on RCSB PDB site
Description: crystal structure of low temperature requirement c protein from listeria monocytogenes
Deposited on 2004-12-15, released 2004-12-28
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-28, with a file datestamp of 2004-12-28.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.211
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Domains in SCOP 1.71: d1y9ia_
  • Chain 'B':
    Domains in SCOP 1.71: d1y9ib_
  • Chain 'C':
    Domains in SCOP 1.71: d1y9ic_
  • Chain 'D':
    Domains in SCOP 1.71: d1y9id_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y9iA (A:)
    mslvekqsaleskarswliergveiddiaelvlflqqkyhpgleldicrqnvehvlrkre
    vqnavltgiqldvmaekgelvqplqniisadeglygvdeilalsivnvygsigftnygyi
    dkvkpgilaklnehdgiavhtflddivgaiaaaaasrlahsyhddivneggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y9iA (A:)
    kqsaleskarswliergveiddiaelvlflqqkyhpgleldicrqnvehvlrkrevqnav
    ltgiqldvmaekgelvqplqniisadeglygvdeilalsivnvygsigftnygyidkvkp
    gilaklnehdgiavhtflddivgaiaaaaasrlahsyhd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y9iB (B:)
    mslvekqsaleskarswliergveiddiaelvlflqqkyhpgleldicrqnvehvlrkre
    vqnavltgiqldvmaekgelvqplqniisadeglygvdeilalsivnvygsigftnygyi
    dkvkpgilaklnehdgiavhtflddivgaiaaaaasrlahsyhddivneggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y9iB (B:)
    kqsaleskarswliergveiddiaelvlflqqkyhpgleldicrqnvehvlrkrevqnav
    ltgiqldvmaekgelvqplqniisadeglygvdeilalsivnvygsigftnygyidkvkp
    gilaklnehdgiavhtflddivgaiaaaaasrlahsyhd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1y9iC (C:)
    mslvekqsaleskarswliergveiddiaelvlflqqkyhpgleldicrqnvehvlrkre
    vqnavltgiqldvmaekgelvqplqniisadeglygvdeilalsivnvygsigftnygyi
    dkvkpgilaklnehdgiavhtflddivgaiaaaaasrlahsyhddivneggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y9iC (C:)
    kqsaleskarswliergveiddiaelvlflqqkyhpgleldicrqnvehvlrkrevqnav
    ltgiqldvmaekgelvqplqniisadeglygvdeilalsivnvygsigftnygyidkvkp
    gilaklnehdgiavhtflddivgaiaaaaasrlahsyhd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1y9iD (D:)
    mslvekqsaleskarswliergveiddiaelvlflqqkyhpgleldicrqnvehvlrkre
    vqnavltgiqldvmaekgelvqplqniisadeglygvdeilalsivnvygsigftnygyi
    dkvkpgilaklnehdgiavhtflddivgaiaaaaasrlahsyhddivneggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y9iD (D:)
    kqsaleskarswliergveiddiaelvlflqqkyhpgleldicrqnvehvlrkrevqnav
    ltgiqldvmaekgelvqplqniisadeglygvdeilalsivnvygsigftnygyidkvkp
    gilaklnehdgiavhtflddivgaiaaaaasrlahsyhd