PDB entry 1y9g

View 1y9g on RCSB PDB site
Description: crystal structure of exo-inulinase from aspergillus awamori complexed with fructose
Deposited on 2004-12-15, released 2004-12-21
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-21, with a file datestamp of 2004-12-21.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: 0.151
AEROSPACI score: 0.51 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y9gA (A:)
    fnydqpyrgqyhfspqknwmndpngllyhngtyhlffqynpggiewgniswghaisedlt
    hweekpvallargfgsdvtemyfsgsavadvnntsgfgkdgktplvamytsyypvaqtlp
    sgqtvqedqqsqsiayslddgltwttydaanpvipnppspyeaeyqnfrdpfvfwhdesq
    kwvvvtsiaelhklaiytsdnlkdwklvsefgpynaqggvwecpglvklpldsgnstkwv
    itsglnpggppgtvgsgtqyfvgefdgttftpdadtvypgnstanwmdwgpdfyaaagyn
    glslndhvhigwmnnwqyganiptypwrsamaiprhmalktigskatlvqqpqeawssis
    nkrpiysrtfktlsegstnttttgetfkvdlsfsakskastfaialrasanfteqtlvgy
    dfakqqifldrthsgdvsfdetfasvyhgpltpdstgvvklsifvdrssvevfggqgett
    ltaqifpssdavharlastggttedvradiykiastwn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y9gA (A:)
    fnydqpyrgqyhfspqknwmndpngllyhngtyhlffqynpggiewgniswghaisedlt
    hweekpvallargfgsdvtemyfsgsavadvnntsgfgkdgktplvamytsyypvaqtlp
    sgqtvqedqqsqsiayslddgltwttydaanpvipnppspyeaeyqnfrdpfvfwhdesq
    kwvvvtsiaelhklaiytsdnlkdwklvsefgpynaqggvwecpglvklpldsgnstkwv
    itsglnpggppgtvgsgtqyfvgefdgttftpdadtvypgnstanwmdwgpdfyaaagyn
    glslndhvhigwmnnwqyganiptypwrsamaiprhmalktigskatlvqqpqeawssis
    nkrpiysrtfktlsegstnttttgetfkvdlsfsakskastfaialrasanfteqtlvgy
    dfakqqifldrthsgdvsfdetfasvyhgpltpdstgvvklsifvdrssvevfggqgett
    ltaqifpssdavharlastggttedvradiykiastw