PDB entry 1y9g

View 1y9g on RCSB PDB site
Description: Crystal structure of exo-inulinase from Aspergillus awamori complexed with fructose
Class: hydrolase
Keywords: Exo-inulinase, Aspergillus awamori, Glycoside hydrolase family 32, Crystallographic structure, Complex with fructose, HYDROLASE
Deposited on 2004-12-15, released 2004-12-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-12-20, with a file datestamp of 2017-12-15.
Experiment type: XRAY
Resolution: 1.87 Å
R-factor: N/A
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: exo-inulinase
    Species: Aspergillus awamori [TaxId:105351]
    Database cross-references and differences (RAF-indexed):
    • GB CAC44220 (0-End)
    Domains in SCOPe 2.07: d1y9ga1, d1y9ga2
  • Heterogens: NAG, FRU, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y9gA (A:)
    fnydqpyrgqyhfspqknwmndpngllyhngtyhlffqynpggiewgniswghaisedlt
    hweekpvallargfgsdvtemyfsgsavadvnntsgfgkdgktplvamytsyypvaqtlp
    sgqtvqedqqsqsiayslddgltwttydaanpvipnppspyeaeyqnfrdpfvfwhdesq
    kwvvvtsiaelhklaiytsdnlkdwklvsefgpynaqggvwecpglvklpldsgnstkwv
    itsglnpggppgtvgsgtqyfvgefdgttftpdadtvypgnstanwmdwgpdfyaaagyn
    glslndhvhigwmnnwqyganiptypwrsamaiprhmalktigskatlvqqpqeawssis
    nkrpiysrtfktlsegstnttttgetfkvdlsfsakskastfaialrasanfteqtlvgy
    dfakqqifldrthsgdvsfdetfasvyhgpltpdstgvvklsifvdrssvevfggqgett
    ltaqifpssdavharlastggttedvradiykiastwn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y9gA (A:)
    fnydqpyrgqyhfspqknwmndpngllyhngtyhlffqynpggiewgniswghaisedlt
    hweekpvallargfgsdvtemyfsgsavadvnntsgfgkdgktplvamytsyypvaqtlp
    sgqtvqedqqsqsiayslddgltwttydaanpvipnppspyeaeyqnfrdpfvfwhdesq
    kwvvvtsiaelhklaiytsdnlkdwklvsefgpynaqggvwecpglvklpldsgnstkwv
    itsglnpggppgtvgsgtqyfvgefdgttftpdadtvypgnstanwmdwgpdfyaaagyn
    glslndhvhigwmnnwqyganiptypwrsamaiprhmalktigskatlvqqpqeawssis
    nkrpiysrtfktlsegstnttttgetfkvdlsfsakskastfaialrasanfteqtlvgy
    dfakqqifldrthsgdvsfdetfasvyhgpltpdstgvvklsifvdrssvevfggqgett
    ltaqifpssdavharlastggttedvradiykiastw