PDB entry 1y9d

View 1y9d on RCSB PDB site
Description: Pyruvate Oxidase variant V265A from Lactobacillus plantarum
Class: oxidoreductase
Keywords: OXIDOREDUCTASE, Pyruvate oxidase
Deposited on 2004-12-15, released 2005-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.181
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyruvate oxidase
    Species: Lactobacillus plantarum [TaxId:1590]
    Gene: pox5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37063
      • engineered (264)
    Domains in SCOPe 2.07: d1y9da1, d1y9da2, d1y9da3
  • Chain 'B':
    Compound: Pyruvate oxidase
    Species: Lactobacillus plantarum [TaxId:1590]
    Gene: pox5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37063
      • engineered (264)
    Domains in SCOPe 2.07: d1y9db1, d1y9db2, d1y9db3
  • Chain 'C':
    Compound: Pyruvate oxidase
    Species: Lactobacillus plantarum [TaxId:1590]
    Gene: pox5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37063
      • engineered (264)
    Domains in SCOPe 2.07: d1y9dc1, d1y9dc2, d1y9dc3
  • Chain 'D':
    Compound: Pyruvate oxidase
    Species: Lactobacillus plantarum [TaxId:1590]
    Gene: pox5
    Database cross-references and differences (RAF-indexed):
    • Uniprot P37063
      • engineered (264)
    Domains in SCOPe 2.07: d1y9dd1, d1y9dd2, d1y9dd3
  • Heterogens: MG, SO4, NA, TPP, FAD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y9dA (A:)
    mvmkqtkqtnilagaavikvleawgvdhlygipggsinsimdalsaerdrihyiqvrhee
    vgamaaaadakltgkigvcfgsagpggthlmnglydaredhvpvlaligqfgttgmnmdt
    fqemnenpiyadvadynvtavnaatlphvideairrayahqgvavvqipvdlpwqqipae
    dwyasansyqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkip
    lmstypakgivadrypaylgsanraaqkpanealaqadvvlfvgnnypfaevskafkntr
    yflqididpaklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwrayl
    asledkqegplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfa
    tmgvgipgaiaaklnyperqvfnlagdggasmtmqdlatqvqyhlpvinvvftncqygfi
    kdeqedtnqndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvli
    davitgdrplpaeklrldsamssaadieafkqryeaqdlqplstylkqfglddlqhqigq
    ggf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y9dA (A:)
    tnilagaavikvleawgvdhlygipggsinsimdalsaerdrihyiqvrheevgamaaaa
    dakltgkigvcfgsagpggthlmnglydaredhvpvlaligqfgttgemnenpiyadvad
    ynvtavnaatlphvideairrayahqgvavvqipvdlpwqqipaedwpllpepdvqavtr
    ltqtllaaerpliyygigarkagkeleqlsktlkiplmstypakgivadrypaylgsanr
    aaqkpanealaqadvvlfvgnnntryflqididpaklgkrhktdiavladaqktlaaila
    qvserestpwwqanlanvknwraylasledkqegplqayqvlravnkiaepdaiysidvg
    dinlnanrhlkltpsnrhitsnlfatmgvgipgaiaaklnyperqvfnlagdggasmtmq
    dlatqvqyhlpvinvvftncqygfikdeqedtnqndfigvefndidfskiadgvhmqafr
    vnkieqlpdvfeqakaiaqhepvlidavitgdrplpaeklrldsamssaadieafkqrye
    aqdlqplstylkqfgldd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y9dB (B:)
    mvmkqtkqtnilagaavikvleawgvdhlygipggsinsimdalsaerdrihyiqvrhee
    vgamaaaadakltgkigvcfgsagpggthlmnglydaredhvpvlaligqfgttgmnmdt
    fqemnenpiyadvadynvtavnaatlphvideairrayahqgvavvqipvdlpwqqipae
    dwyasansyqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkip
    lmstypakgivadrypaylgsanraaqkpanealaqadvvlfvgnnypfaevskafkntr
    yflqididpaklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwrayl
    asledkqegplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfa
    tmgvgipgaiaaklnyperqvfnlagdggasmtmqdlatqvqyhlpvinvvftncqygfi
    kdeqedtnqndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvli
    davitgdrplpaeklrldsamssaadieafkqryeaqdlqplstylkqfglddlqhqigq
    ggf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y9dB (B:)
    tnilagaavikvleawgvdhlygipggsinsimdalsaerdrihyiqvrheevgamaaaa
    dakltgkigvcfgsagpggthlmnglydaredhvpvlaligqfgttgmqemnenpiyadv
    adynvtavnaatlphvideairrayahqgvavvqipvdlpwqqipaedwyqtpllpepdv
    qavtrltqtllaaerpliyygigarkagkeleqlsktlkiplmstypakgivadrypayl
    gsanraaqkpanealaqadvvlfvgnnypafkntryflqididpaklgkrhktdiavlad
    aqktlaailaqvserestpwwqanlanvknwraylasledkqegplqayqvlravnkiae
    pdaiysidvgdinlnanrhlkltpsnrhitsnlfatmgvgipgaiaaklnyperqvfnla
    gdggasmtmqdlatqvqyhlpvinvvftncqygfikdeqedtnqndfigvefndidfski
    adgvhmqafrvnkieqlpdvfeqakaiaqhepvlidavitgdrplpaeklrldsamssaa
    dieafkqryeaqdlqplstylkqfglddlqhq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1y9dC (C:)
    mvmkqtkqtnilagaavikvleawgvdhlygipggsinsimdalsaerdrihyiqvrhee
    vgamaaaadakltgkigvcfgsagpggthlmnglydaredhvpvlaligqfgttgmnmdt
    fqemnenpiyadvadynvtavnaatlphvideairrayahqgvavvqipvdlpwqqipae
    dwyasansyqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkip
    lmstypakgivadrypaylgsanraaqkpanealaqadvvlfvgnnypfaevskafkntr
    yflqididpaklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwrayl
    asledkqegplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfa
    tmgvgipgaiaaklnyperqvfnlagdggasmtmqdlatqvqyhlpvinvvftncqygfi
    kdeqedtnqndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvli
    davitgdrplpaeklrldsamssaadieafkqryeaqdlqplstylkqfglddlqhqigq
    ggf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y9dC (C:)
    tnilagaavikvleawgvdhlygipggsinsimdalsaerdrihyiqvrheevgamaaaa
    dakltgkigvcfgsagpggthlmnglydaredhvpvlaligqfgttgemnenpiyadvad
    ynvtavnaatlphvideairrayahqgvavvqipvdlpwqqipaelpepdvqavtrltqt
    llaaerpliyygigarkagkeleqlsktlkiplmstypakgivadrypaylgsanraaqk
    panealaqadvvlfvgnnykntryflqididpaklgkrhktdiavladaqktlaailaqv
    serestpwwqanlanvknwraylasledkqegplqayqvlravnkiaepdaiysidvgdi
    nlnanrhlkltpsnrhitsnlfatmgvgipgaiaaklnyperqvfnlagdggasmtmqdl
    atqvqyhlpvinvvftncqygfikdeqedtnqndfigvefndidfskiadgvhmqafrvn
    kieqlpdvfeqakaiaqhepvlidavitgdrplpaeklrldsamssaadieafkqryeaq
    dlqplstylkqfgldd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1y9dD (D:)
    mvmkqtkqtnilagaavikvleawgvdhlygipggsinsimdalsaerdrihyiqvrhee
    vgamaaaadakltgkigvcfgsagpggthlmnglydaredhvpvlaligqfgttgmnmdt
    fqemnenpiyadvadynvtavnaatlphvideairrayahqgvavvqipvdlpwqqipae
    dwyasansyqtpllpepdvqavtrltqtllaaerpliyygigarkagkeleqlsktlkip
    lmstypakgivadrypaylgsanraaqkpanealaqadvvlfvgnnypfaevskafkntr
    yflqididpaklgkrhktdiavladaqktlaailaqvserestpwwqanlanvknwrayl
    asledkqegplqayqvlravnkiaepdaiysidvgdinlnanrhlkltpsnrhitsnlfa
    tmgvgipgaiaaklnyperqvfnlagdggasmtmqdlatqvqyhlpvinvvftncqygfi
    kdeqedtnqndfigvefndidfskiadgvhmqafrvnkieqlpdvfeqakaiaqhepvli
    davitgdrplpaeklrldsamssaadieafkqryeaqdlqplstylkqfglddlqhqigq
    ggf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y9dD (D:)
    tnilagaavikvleawgvdhlygipggsinsimdalsaerdrihyiqvrheevgamaaaa
    dakltgkigvcfgsagpggthlmnglydaredhvpvlaligqfgttgemnenpiyadvad
    ynvtavnaatlphvideairrayahqgvavvqipvdlpwqqipaedwyasapepdvqavt
    rltqtllaaerpliyygigarkagkeleqlsktlkiplmstypakgivadrypaylgsan
    raaqkpanealaqadvvlfvgnnyntryflqididpaklgkrhktdiavladaqktlaai
    laqvserestpwwqanlanvknwraylasledkqegplqayqvlravnkiaepdaiysid
    vgdinlnanrhlkltpsnrhitsnlfatmgvgipgaiaaklnyperqvfnlagdggasmt
    mqdlatqvqyhlpvinvvftncqygfikdeqedtnqndfigvefndidfskiadgvhmqa
    frvnkieqlpdvfeqakaiaqhepvlidavitgdrplpaeklrldsamssaadieafkqr
    yeaqdlqplstylkqfgldd