PDB entry 1y9b

View 1y9b on RCSB PDB site
Description: Structure of Conserved Putative Transcriptional Factor from Vibrio cholerae O1 biovar eltor str. N16961
Class: structural genomics, unknown function
Keywords: MCSG, structural genomics, Vibrio cholerae, conserved hypothetical protein, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, UNKNOWN FUNCTION
Deposited on 2004-12-15, released 2005-01-25
The last revision prior to the SCOPe 2.05 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.227
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: conserved hypothetical protein
    Species: Vibrio cholerae [TaxId:243277]
    Gene: VCA0319
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K2J6
      • modified residue (28)
      • modified residue (64)
    Domains in SCOPe 2.05: d1y9ba1
  • Chain 'B':
    Compound: conserved hypothetical protein
    Species: Vibrio cholerae [TaxId:243277]
    Gene: VCA0319
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9K2J6
      • modified residue (28)
      • modified residue (64)
    Domains in SCOPe 2.05: d1y9bb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y9bA (A:)
    mattlpritarvdvdtqdllakaaalagmssinsfvlnaaiekakqviereqalklsqad
    avllmealdnpavvnaklklaseryesktq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y9bA (A:)
    ttlpritarvdvdtqdllakaaalagmssinsfvlnaaiekakqviereqalklsqadav
    llmealdnpavvnaklklase
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y9bB (B:)
    mattlpritarvdvdtqdllakaaalagmssinsfvlnaaiekakqviereqalklsqad
    avllmealdnpavvnaklklaseryesktq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y9bB (B:)
    pritarvdvdtqdllakaaalagmssinsfvlnaaiekakqviereqalklsqadavllm
    ealdnpavvnaklklase