PDB entry 1y9a

View 1y9a on RCSB PDB site
Description: alcohol dehydrogenase from entamoeba histolotica in complex with cacodylate
Deposited on 2004-12-15, released 2006-01-17
The last revision was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.81 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: NADP-dependent alcohol dehydrogenase
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: ADH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35630 (0-359)
      • modified residue (244)
  • Chain 'C':
    Compound: NADP-dependent alcohol dehydrogenase
    Species: Entamoeba histolytica [TaxId:5759]
    Gene: ADH1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P35630 (0-359)
      • modified residue (244)
  • Heterogens: ZN, CAC, ACT, MG, EDO, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1y9aA (A:)
    mkglamlgigrigwiekkipecgpldalvrplalapctsdthtvwagaigdrhdmilghe
    avgqivkvgslvkrlkvgdkvivpaitpdwgeeesqrgypmhsggmlggwkfsnfkdgvf
    sevfhvneadanlallprdikpedavmlsdmvttgfhgaelaniklgdtvcvigigpvgl
    msvaganhlgagrifavgsrkhccdialeygatdiinykngdiveqilkatdgkgvdkvv
    iaggdvhtfaqavkmikpgsdignvnylgegdnidiprsewgvgmghkhihggltpggrv
    rmeklaslistgkldtsklithrfeglekvedalmlmknkpadlikpvvrihyddedtlh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >1y9aC (C:)
    mkglamlgigrigwiekkipecgpldalvrplalapctsdthtvwagaigdrhdmilghe
    avgqivkvgslvkrlkvgdkvivpaitpdwgeeesqrgypmhsggmlggwkfsnfkdgvf
    sevfhvneadanlallprdikpedavmlsdmvttgfhgaelaniklgdtvcvigigpvgl
    msvaganhlgagrifavgsrkhccdialeygatdiinykngdiveqilkatdgkgvdkvv
    iaggdvhtfaqavkmikpgsdignvnylgegdnidiprsewgvgmghkhihggltpggrv
    rmeklaslistgkldtsklithrfeglekvedalmlmknkpadlikpvvrihyddedtlh