PDB entry 1y98

View 1y98 on RCSB PDB site
Description: Structure of the BRCT repeats of BRCA1 bound to a CtIP phosphopeptide.
Class: antitumor protein
Keywords: BREAST CANCER, BRCT, BRCA1, CtIP, PHOSPHOPEPTIDE, ANTITUMOR PROTEIN
Deposited on 2004-12-14, released 2005-08-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.236
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: breast cancer type 1 susceptibility protein
    Species: Homo sapiens [TaxId:9606]
    Gene: BRCA1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y98a1, d1y98a2
  • Chain 'B':
    Compound: CtIP PHOSPHORYLATED PEPTIDE
    Species: synthetic, synthetic
    Database cross-references and differences (RAF-indexed):
    • PDB 1Y98 (0-11)
  • Heterogens: CO, SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y98A (A:)
    vnkrmsmvvsgltpeefmlvykfarkhhitltnliteetthvvmktdaefvcertlkyfl
    giaggkwvvsyfwvtqsikerkmlnehdfevrgdvvngrnhqgpkraresqdrkifrgle
    iccygpftnmptdqlewmvqlcgasvvkelssftlgtgvhpivvvqpdawtedngfhaig
    qmceapvvtrewvldsvalyqcqeldtylipqip
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y98A (A:)
    rmsmvvsgltpeefmlvykfarkhhitltnliteetthvvmktdaefvcertlkyflgia
    ggkwvvsyfwvtqsikerkmlnehdfevrgdvvngrnhqgpkraresqdrkifrgleicc
    ygpftnmptdqlewmvqlcgasvvkelssftlgtgvhpivvvqpdawtedngfhaigqmc
    eapvvtrewvldsvalyqcqeldtylipqip
    

  • Chain 'B':
    No sequence available.