PDB entry 1y97

View 1y97 on RCSB PDB site
Description: The human TREX2 3' exonuclease structure suggests a mechanism for efficient non-processive DNA catalysis
Class: hydrolase
Keywords: TREX2, exonuclease, HYDROLASE
Deposited on 2004-12-14, released 2005-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.205
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Three prime repair exonuclease 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TREX2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BQ50 (2-End)
      • cloning artifact (0-1)
      • modified residue (2)
      • modified residue (65)
      • modified residue (226)
    Domains in SCOPe 2.07: d1y97a1, d1y97a2
  • Chain 'B':
    Compound: Three prime repair exonuclease 2
    Species: Homo sapiens [TaxId:9606]
    Gene: TREX2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9BQ50
      • modified residue (65)
      • modified residue (226)
    Domains in SCOPe 2.07: d1y97b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y97A (A:)
    agmseapraetfvfldleatglpsvepeiaelslfavhrsslenpehdesgalvlprvld
    kltlcmcperpftakaseitglsseglarcrkagfdgavvrtlqaflsrqagpiclvahn
    gfdydfpllcaelrrlgarlprdtvcldtlpalrgldrahshgtrargrqgyslgslfhr
    yfraepsaahsaegdvhtllliflhraaellawadeqargwahiepmylppddpslea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y97A (A:)
    agmseapraetfvfldleatglpsvepeiaelslfavhrsslenpehgalvlprvldklt
    lcmcperpftakaseitglsseglarcrkagfdgavvrtlqaflsrqagpiclvahngfd
    ydfpllcaelrrlgarlprdtvcldtlpalrgldrahgyslgslfhryfraepssaegdv
    htllliflhraaellawadeqargwahiepmylp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y97B (B:)
    agmseapraetfvfldleatglpsvepeiaelslfavhrsslenpehdesgalvlprvld
    kltlcmcperpftakaseitglsseglarcrkagfdgavvrtlqaflsrqagpiclvahn
    gfdydfpllcaelrrlgarlprdtvcldtlpalrgldrahshgtrargrqgyslgslfhr
    yfraepsaahsaegdvhtllliflhraaellawadeqargwahiepmylppddpslea
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y97B (B:)
    eapraetfvfldleatglpsvepeiaelslfavhrsslenpehdesgalvlprvldkltl
    cmcperpftakaseitglsseglarcrkagfdgavvrtlqaflsrqagpiclvahngfdy
    dfpllcaelrrlgarlprdtvcldtlpalrgldrgyslgslfhryfraephsaegdvhtl
    lliflhraaellawadeqargwahiepmylp