PDB entry 1y96

View 1y96 on RCSB PDB site
Description: crystal structure of the Gemin6/Gemin7 heterodimer from the human SMN complex
Deposited on 2004-12-14, released 2005-06-21
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.219
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Gem-associated protein 6
    Species: Homo sapiens [TaxId:9606]
    Gene: GEMIN6
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Gem-associated protein 7
    Species: Homo sapiens [TaxId:9606]
    Gene: GEMIN7
    Database cross-references and differences (RAF-indexed):
  • Chain 'C':
    Compound: Gem-associated protein 6
    Species: Homo sapiens [TaxId:9606]
    Gene: GEMIN6
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Gem-associated protein 7
    Species: Homo sapiens [TaxId:9606]
    Gene: GEMIN7
    Database cross-references and differences (RAF-indexed):
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1y96A (A:)
    msewmkkgplewqdyiykevrvtasekneykgwvlttdpvsanivlvnfledgsmsvtgi
    mghavqtvetmnegdhrvreklmhlf
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1y96B (B:)
    aqeslesqeqraraalrerylrsllamvghqvsftlhegvrvaahfgatdldvanfyvsq
    lqtpigvqaeallrcsdiisytfkp
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records:
    >1y96C (C:)
    msewmkkgplewqdyiykevrvtasekneykgwvlttdpvsanivlvnfledgsmsvtgi
    mghavqtvetmnegdhrvreklmhlf
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1y96D (D:)
    aqeslesqeqraraalrerylrsllamvghqvsftlhegvrvaahfgatdldvanfyvsq
    lqtpigvqaeallrcsdiisytfkp
    

    Sequence, based on observed residues (ATOM records):
    >1y96D (D:)
    eslesqeqraraalrerylrsllamvghqvsftlhegvrvaahfgatdldvanfyvsqlq
    tpigvqaeallrcsdiisytfkp