PDB entry 1y94

View 1y94 on RCSB PDB site
Description: Crystal structure of the G16S/N17T/P19A/S20A/N67D Variant Of Bovine seminal Ribonuclease
Class: hydrolase
Keywords: nuclease, hydrolase
Deposited on 2004-12-14, released 2004-12-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-09.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.208
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Seminal ribonuclease
    Species: Bos taurus [TaxId:9913]
    Gene: SRN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00669 (0-123)
      • engineered (15-16)
      • engineered (18-19)
      • engineered (66)
    Domains in SCOPe 2.08: d1y94a_
  • Chain 'B':
    Compound: Seminal ribonuclease
    Species: Bos taurus [TaxId:9913]
    Gene: SRN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00669 (0-123)
      • engineered (15-16)
      • engineered (18-19)
      • engineered (66)
    Domains in SCOPe 2.08: d1y94b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y94A (A:)
    kesaaakferqhmdsstsaasssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
    kkvtckdgqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
    dasv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y94B (B:)
    kesaaakferqhmdsstsaasssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
    kkvtckdgqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
    dasv