PDB entry 1y93

View 1y93 on RCSB PDB site
Description: Crystal structure of the catalytic domain of human MMP12 complexed with acetohydroxamic acid at atomic resolution
Class: hydrolase
Keywords: MATRIX METALLOPROTEINASE, MMP12, ELASTASE, COMPLEX (ELASTASE-INHIBITOR), METALLO ELASTASE, ACETOHYDROXAMIC ACID, hydrolase
Deposited on 2004-12-14, released 2005-04-26
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.03 Å
R-factor: 0.157
AEROSPACI score: 0.96 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage metalloelastase
    Species: Homo sapiens [TaxId:9606]
    Gene: MMP12, HME
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39900 (1-158)
      • engineered (66)
    Domains in SCOPe 2.06: d1y93a_
  • Heterogens: ZN, CA, HAE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y93A (A:)
    mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
    rgahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
    glghssdpkavmfptykyvdintfrlsaddirgiqslyg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y93A (A:)
    gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
    gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
    lghssdpkavmfptykyvdintfrlsaddirgiqslyg