PDB entry 1y93

View 1y93 on RCSB PDB site
Description: Crystal structure of the catalytic domain of human MMP12 complexed with acetohydroxamic acid at atomic resolution
Class: hydrolase
Keywords: matrix metalloproteinase, mmp12, elastase, complex (elastase/inhibitor), metallo elastase, acetohydroxamic acid
Deposited on 2004-12-14, released 2005-04-26
The last revision prior to the SCOP 1.73 freeze date was dated 2005-04-26, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.03 Å
R-factor: 0.157
AEROSPACI score: 0.96 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Macrophage metalloelastase
    Species: HOMO SAPIENS
    Gene: MMP12, HME
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39900 (1-158)
      • engineered (66)
    Domains in SCOP 1.73: d1y93a1
  • Heterogens: ZN, CA, HAE, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1y93A (A:)
mgpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfa
rgahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighsl
glghssdpkavmfptykyvdintfrlsaddirgiqslyg

    Sequence, based on observed residues (ATOM records): (download) 
    >1y93A (A:)
gpvwrkhyityrinnytpdmnredvdyairkafqvwsnvtplkfskintgmadilvvfar
gahgddhafdgkggilahafgpgsgiggdahfdedefwtthsggtnlfltavheighslg
lghssdpkavmfptykyvdintfrlsaddirgiqslyg