PDB entry 1y92

View 1y92 on RCSB PDB site
Description: Crystal structure of the P19A/N67D Variant Of Bovine seminal Ribonuclease
Class: hydrolase
Keywords: nuclease, HYDROLASE
Deposited on 2004-12-14, released 2004-12-28
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.171
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Seminal ribonuclease
    Species: Bos taurus [TaxId:9913]
    Gene: SRN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00669 (0-123)
      • engineered (66)
    Domains in SCOPe 2.05: d1y92a_
  • Chain 'B':
    Compound: Seminal ribonuclease
    Species: Bos taurus [TaxId:9913]
    Gene: SRN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P00669 (0-123)
      • engineered (18)
      • engineered (66)
    Domains in SCOPe 2.05: d1y92b_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y92A (A:)
    kesaaakferqhmdsgnsassssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
    kkvtckdgqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
    dasv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y92A (A:)
    kesaaakferqhmdsgsssnycnlmmccrkmtqgkckpvntfvhesladvkavcsqkkvt
    ckdgqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhfdasv
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y92B (B:)
    kesaaakferqhmdsgnsassssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
    kkvtckdgqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
    dasv