PDB entry 1y8z

View 1y8z on RCSB PDB site
Description: alpha-glucosyltransferase in complex with udp and a 13-mer dna containing a hmu base at 1.9 a resolution
Deposited on 2004-12-14, released 2005-08-30
The last revision was dated 2020-07-22, with a file datestamp of 2020-07-17.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.208
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA alpha-glucosyltransferase
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04519 (2-401)
      • cloning artifact (0-1)
      • modified residue (15)
      • modified residue (275)
  • Chain 'B':
    Compound: DNA alpha-glucosyltransferase
    Species: Enterobacteria phage T4 sensu lato [TaxId:10665]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P04519 (2-401)
      • cloning artifact (0-1)
      • modified residue (15)
      • modified residue (275)
  • Chain 'C':
    Compound: 5'-d(*gp*ap*tp*ap*cp*tp*(5hu)p*ap*gp*ap*tp*ap*g)-3'
  • Chain 'D':
    Compound: 5'-d(*cp*tp*ap*tp*cp*tp*gp*ap*g)-3'
  • Heterogens: NCO, UDP, GOL, CL, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1y8zA (A:)
    gsmricifmarglegcgvtkfsleqrdwfiknghevtlvyakdksftrtsshdhksfsip
    vilakeydkalklvndcdiliinsvpatsvqeatinnykklldnikpsirvvvyqhdhsv
    lslrrnlgleetvrradvifshsdngdfnkvlmkewypetvslfddieeaptvynfqppm
    divkvrstywkdvseinmninrwigrtttwkgfyqmfdfhekflkpagkstvmeglersp
    afiaikekgipyeyygnreidkmnlapnqpaqildcyinsemlermsksgfgyqlsklnq
    kylqrsleythlelgacgtipvfwkstgenlkfrvdntpltshdsgiiwfdendmestfe
    rikelssdralydrerekayeflyqhqdssfcfkeqfdiitk
    

    Sequence, based on observed residues (ATOM records):
    >1y8zA (A:)
    gsmricifmarglegcgvtkfsleqrdwfiknghevtlvyakdksftrtsshdhksfsip
    vilakeydkalklvndcdiliinsvpatsvqeatinnykklldnikpsirvvvyqhdhsv
    lslrrnlgleetvrradvifshsdngdfnkvlmkewypaptvynfqppmdivkvrstywk
    dvseinmninrwigrtttwkgfyqmfdfhekflkpagkstvmeglerspafiaikekgip
    yeyygnreidkmnlapnqpaqildcyinsemlermsksgfgyqlsklnqkylqrsleyth
    lelgacgtipvfwkstgenlkfrvdntpltshdsgiiwfdendmestferikelssdral
    ydrerekayeflyqhqdssfcfkeqfdiitk
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1y8zB (B:)
    gsmricifmarglegcgvtkfsleqrdwfiknghevtlvyakdksftrtsshdhksfsip
    vilakeydkalklvndcdiliinsvpatsvqeatinnykklldnikpsirvvvyqhdhsv
    lslrrnlgleetvrradvifshsdngdfnkvlmkewypetvslfddieeaptvynfqppm
    divkvrstywkdvseinmninrwigrtttwkgfyqmfdfhekflkpagkstvmeglersp
    afiaikekgipyeyygnreidkmnlapnqpaqildcyinsemlermsksgfgyqlsklnq
    kylqrsleythlelgacgtipvfwkstgenlkfrvdntpltshdsgiiwfdendmestfe
    rikelssdralydrerekayeflyqhqdssfcfkeqfdiitk
    

    Sequence, based on observed residues (ATOM records):
    >1y8zB (B:)
    gsmricifmarglegcgvtkfsleqrdwfiknghevtlvyakdksftrtsshdhksfsip
    vilakeydkalklvndcdiliinsvpatsvqeatinnykklldnikpsirvvvyqhdhsv
    lslrrnlgleetvrradvifshsvynfqppmdivkvrstywkdvseinmninrwigrttt
    wkgfyqmfdfhekflkpagkstvmeglerspafiaikekgipyeyygnreidkmnlapnq
    paqildcyinsemlermsksgfgyqlsklnqkylqrsleythlelgacgtipvfwkstge
    nlkfrvdntpltshdsgiiwfdendmestferikelssdralydrerekayeflyqhqds
    sfcfkeqfdiitk
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.