PDB entry 1y8x

View 1y8x on RCSB PDB site
Description: Structural basis for recruitment of Ubc12 by an E2-binding domain in NEDD8's E1
Class: ligase
Keywords: Ubiquitin-conjugating enzyme E2 M, LIGASE
Deposited on 2004-12-13, released 2005-02-08
The last revision prior to the SCOPe 2.02 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.242
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-conjugating enzyme E2 M
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE2M, UBC12
    Database cross-references and differences (RAF-indexed):
    • Uniprot P61081 (3-159)
      • cloning artifact (0-2)
      • modified residue (74)
      • modified residue (144)
    Domains in SCOPe 2.02: d1y8xa1
  • Chain 'B':
    Compound: ubiquitin-activating enzyme E1C
    Species: Homo sapiens [TaxId:9606]
    Gene: UBE1C, UBA3
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8TBC4
      • modified residue (31)
      • engineered (49)
    Domains in SCOPe 2.02: d1y8xb1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y8xA (A:)
    gsmasaaqlriqkdinelnlpktcdisfsdpddllnfklvicpdegfyksgkfvfsfkvg
    qgyphdppkvkcetmvyhpnidlegnvclnilredwkpvltinsiiyglqylflepnped
    plnkeaaevlqnnrrlfeqnvqrsmrggyigstyferclk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y8xB (B:)
    gssqlpqniqfspsaklqevldyltnsaslqmkspaitatlegknrtlymqsvtsieert
    rpnlsktlkelglvdgqelavadvttpqtvlfklhfts
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y8xB (B:)
    lpqniqfspsaklqevldyltnsaslqmkspaitatlegknrtlymqsvtsieertrpnl
    sktlkelglvdgqelavadvttpqtvlfklhf