PDB entry 1y8q

View 1y8q on RCSB PDB site
Description: sumo e1 activating enzyme sae1-sae2-mg-atp complex
Deposited on 2004-12-13, released 2005-01-25
The last revision was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.208
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Ubiquitin-like 1 activating enzyme E1A
    Species: Homo sapiens [TaxId:9606]
    Gene: UBLE1A, SAE1
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Ubiquitin-like 2 activating enzyme E1B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBLE1B, SAE2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UBT2
      • engineered (172)
  • Chain 'C':
    Compound: Ubiquitin-like 1 activating enzyme E1A
    Species: Homo sapiens [TaxId:9606]
    Gene: UBLE1A, SAE1
    Database cross-references and differences (RAF-indexed):
  • Chain 'D':
    Compound: Ubiquitin-like 2 activating enzyme E1B
    Species: Homo sapiens [TaxId:9606]
    Gene: UBLE1B, SAE2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9UBT2
      • engineered (172)
  • Heterogens: MG, ZN, ATP, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1y8qA (A:)
    mvekeeagggiseeeaaqydrqirlwgleaqkrlrasrvllvglkglgaeiaknlilagv
    kgltmldheqvtpedpgaqflirtgsvgrnraeasleraqnlnpmvdvkvdtediekkpe
    sfftqfdavcltccsrdvivkvdqichknsikfftgdvfgyhgytfanlgehefveektk
    vakvsqgvedgpdtkrakldssettmvkkkvvfcpvkealevdwssekakaalkrttsdy
    fllqvllkfrtdkgrdpssdtyeedselllqirndvldslgispdllpedfvrycfsema
    pvcavvggilaqeivkalsqrdpphnnffffdgmkgngiveclgpk
    

    Sequence, based on observed residues (ATOM records):
    >1y8qA (A:)
    giseeeaaqydrqirlwgleaqkrlrasrvllvglkglgaeiaknlilagvkgltmldhe
    qvtpedpgaqflirtgsvgrnraeasleraqnlnpmvdvkvdtediekkpesfftqfdav
    cltccsrdvivkvdqichknsikfftgdvfgyhgytfanlgehefveektettmvkkkvv
    fcpvkealevdwssekakaalkrttsdyfllqvllkfrtdkgrdpssdtyeedselllqi
    rndvldslgispdllpedfvrycfsemapvcavvggilaqeivkalsqrdpphnnffffd
    gmkgngiveclgp
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1y8qB (B:)
    malsrglprelaeavaggrvlvvgaggigcellknlvltgfshidlidldtidvsnlnrq
    flfqkkhvgrskaqvakesvlqfypkanivayhdsimnpdynveffrqfilvmnaldnra
    arnhvnrmclaadvpliesgtagylgqvttikkgvtecyechpkptqrtfpgatirntps
    epihcivwakylfnqlfgeedadqevspdradpeaawepteaeararasnedgdikrist
    kewakstgydpvklftklfkddirylltmdklwrkrkppvpldwaevqsqgeetnasdqq
    nepqlglkdqqvldvksyarlfsksietlrvhlaekgdgaeliwdkddpsamdfvtsaan
    lrmhifsmnmksrfdiksmagniipaiattnaviaglivleglkilsgkidqcrtiflnk
    qpnprkkllvpcaldppnpncyvcaskpevtvrlnvhkvtvltlqdkivkekfamvapdv
    qiedgkgtilisseegeteannhkklsefgirngsrlqaddflqdytllinilhsedlgk
    dvefevvgdapekvgpkqaedaaksitngsddgaqpststaqeqddvlivdsdeedssnn
    advseeersrkrkldekenlsakrsrieqkeelddviald
    

    Sequence, based on observed residues (ATOM records):
    >1y8qB (B:)
    glprelaeavaggrvlvvgaggigcellknlvltgfshidlidldtidvsnlnrqflfqk
    khvgrskaqvakesvlqfypkanivayhdsimnpdynveffrqfilvmnaldnraarnhv
    nrmclaadvpliesgtagylgqvttikkgvtecyechpkptqrtfpgatirntpsepihc
    ivwakylfnqlfgeedadqevspdradpeaawetkewakstgydpvklftklfkddiryl
    ltmdklwrkrkppvpldwaevqsqlglkdqqvldvksyarlfsksietlrvhlaekgdga
    eliwdkddpsamdfvtsaanlrmhifsmnmksrfdiksmagniipaiattnaviaglivl
    eglkilsgkidqcrtiflnkqpnprkkllvpcaldppnpncyvcaskpevtvrlnvhkvt
    vltlqdkivkekfamvapdvqiedgkgtilisseegeteannhkklsefgirngsrlqad
    dflqdytllinilhsedlgkdvefevvgda
    

  • Chain 'C':
    Sequence, based on SEQRES records:
    >1y8qC (C:)
    mvekeeagggiseeeaaqydrqirlwgleaqkrlrasrvllvglkglgaeiaknlilagv
    kgltmldheqvtpedpgaqflirtgsvgrnraeasleraqnlnpmvdvkvdtediekkpe
    sfftqfdavcltccsrdvivkvdqichknsikfftgdvfgyhgytfanlgehefveektk
    vakvsqgvedgpdtkrakldssettmvkkkvvfcpvkealevdwssekakaalkrttsdy
    fllqvllkfrtdkgrdpssdtyeedselllqirndvldslgispdllpedfvrycfsema
    pvcavvggilaqeivkalsqrdpphnnffffdgmkgngiveclgpk
    

    Sequence, based on observed residues (ATOM records):
    >1y8qC (C:)
    ggiseeeaaqydrqirlwgleaqkrlrasrvllvglkglgaeiaknlilagvkgltmldh
    eqvtpedpgaqflirtgsvgrnraeasleraqnlnpmvdvkvdtediekkpesfftqfda
    vcltccsrdvivkvdqichknsikfftgdvfgyhgytfanlgehefveettmvkkkvvfc
    pvkealevdwssekakaalkrttsdyfllqvllkfrtdkgrdpssdtyeedselllqirn
    dvldslgispdllpedfvrycfsemapvcavvggilaqeivkalsqrdpphnnffffdgm
    kgngiveclgp
    

  • Chain 'D':
    Sequence, based on SEQRES records:
    >1y8qD (D:)
    malsrglprelaeavaggrvlvvgaggigcellknlvltgfshidlidldtidvsnlnrq
    flfqkkhvgrskaqvakesvlqfypkanivayhdsimnpdynveffrqfilvmnaldnra
    arnhvnrmclaadvpliesgtagylgqvttikkgvtecyechpkptqrtfpgatirntps
    epihcivwakylfnqlfgeedadqevspdradpeaawepteaeararasnedgdikrist
    kewakstgydpvklftklfkddirylltmdklwrkrkppvpldwaevqsqgeetnasdqq
    nepqlglkdqqvldvksyarlfsksietlrvhlaekgdgaeliwdkddpsamdfvtsaan
    lrmhifsmnmksrfdiksmagniipaiattnaviaglivleglkilsgkidqcrtiflnk
    qpnprkkllvpcaldppnpncyvcaskpevtvrlnvhkvtvltlqdkivkekfamvapdv
    qiedgkgtilisseegeteannhkklsefgirngsrlqaddflqdytllinilhsedlgk
    dvefevvgdapekvgpkqaedaaksitngsddgaqpststaqeqddvlivdsdeedssnn
    advseeersrkrkldekenlsakrsrieqkeelddviald
    

    Sequence, based on observed residues (ATOM records):
    >1y8qD (D:)
    srglprelaeavaggrvlvvgaggigcellknlvltgfshidlidldtidvsnlnrqflf
    qkkhvgrskaqvakesvlqfypkanivayhdsimnpdynveffrqfilvmnaldnraarn
    hvnrmclaadvpliesgtagylgqvttikkgvtecyechpkptqrtfpgatirntpsepi
    hcivwakylfnqlfgeedadqevspdradpeaaweistkewakstgydpvklftklfkdd
    irylltmdklwrkrkppvpldwaevqsqlglkdqqvldvksyarlfsksietlrvhlaek
    gdgaeliwdkddpsamdfvtsaanlrmhifsmnmksrfdiksmagniipaiattnaviag
    livleglkilsgkidqcrtiflnkqpnprkkllvpcaldppnpncyvcaskpevtvrlnv
    hkvtvltlqdkivkekfamvapdvqiedgkgtilisseegeteannhkklsefgirngsr
    lqaddflqdytllinilhsedlgkdvefevvgda