PDB entry 1y8m

View 1y8m on RCSB PDB site
Description: Solution Structure of Yeast Mitochondria Fission Protein Fis1
Class: unknown function
Keywords: Mitochondria, Fission, UNKNOWN FUNCTION
Deposited on 2004-12-13, released 2005-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Fis1
  Species: Saccharomyces cerevisiae [TaxId:4932]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P40515 (0-137)
    • expression tag (138-143)
  Domains in SCOPe 2.07: d1y8ma1, d1y8ma2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1y8mA (A:)
  mtkvdfwptlkdayeplypqqleilrqqvvseggptatiqsrfnyawglikstdvnderl
  gvkiltdiykeaesrrreclyyltigcyklgeysmakryvdtlfehernnkqvgalksmv
  edkiqketlkgvvvaggvhhhhhh