PDB entry 1y8m

View 1y8m on RCSB PDB site
Description: Solution Structure of Yeast Mitochondria Fission Protein Fis1
Class: unknown function
Keywords: Mitochondria, Fission, UNKNOWN FUNCTION
Deposited on 2004-12-13, released 2005-04-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fis1
    Species: Saccharomyces cerevisiae [TaxId:4932]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P40515 (0-137)
      • expression tag (138-143)
    Domains in SCOPe 2.08: d1y8ma1, d1y8ma2

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y8mA (A:)
    mtkvdfwptlkdayeplypqqleilrqqvvseggptatiqsrfnyawglikstdvnderl
    gvkiltdiykeaesrrreclyyltigcyklgeysmakryvdtlfehernnkqvgalksmv
    edkiqketlkgvvvaggvhhhhhh