PDB entry 1y8j

View 1y8j on RCSB PDB site
Description: Crystal Structure of human NEP complexed with an imidazo[4,5-c]pyridine inhibitor
Class: hydrolase
Keywords: lt1_6, hydrolase
Deposited on 2004-12-13, released 2005-06-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.23
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Neprilysin
    Species: Homo sapiens [TaxId:9606]
    Gene: MME, EPN
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1y8ja_
  • Heterogens: NAG, ZN, ACT, STS, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y8jA (A:)
    gickssdciksaarliqnmdattepctdffkyacggwlkrnvipetssrygnfdilrdel
    evvlkdvlqepktedivavqkakalyrscinesaidsrggepllkllpdiygwpvatenw
    eqkygaswtaekaiaqlnskygkkvlinlfvgtddknsvnhvihidqprlglpsrdyyec
    tgiykeactayvdfmisvarlirqeerlpidenqlalemnkvmelekeianatakpedrn
    dpmllynkmtlaqiqnnfsleingkpfswlnftneimstvnisitneedvvvyapeyltk
    lkpiltkysardlqnlmswrfimdlvsslsrtykesrnafrkalygttsetatwrrcany
    vngnmenavgrlyveaafageskhvvedliaqirevfiqtlddltwmdaetkkraeekal
    aikerigypddivsndnklnneylelnykedeyfeniiqnlkfsqskqlkklrekvdkde
    wisgaavvnafyssgrnqivfpagilqppffsaqqsnslnyggigmvigheithgfddng
    rnfnkdgdlvdwwtqqsasnfkeqsqcmvyqygnfswdlaggqhlngintlgeniadngg
    lgqayrayqnyikkngeekllpgldlnhkqlfflnfaqvwcgtyrpeyavnsiktdvhsp
    gnfriigtlqnsaefseafhcrknsymnpekkcrvw