PDB entry 1y8i

View 1y8i on RCSB PDB site
Description: Horse methemoglobin low salt, PH 7.0 (98% relative humidity)
Class: oxygen storage/transport
Keywords: aquo methemoglobin, quarternary association, allosteric transition, protein hydration, oxygen storage/transport complex
Deposited on 2004-12-13, released 2005-07-26
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.167
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin alpha chains
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01958 (0-140)
      • conflict (81)
      • conflict (84)
    Domains in SCOPe 2.04: d1y8ia_
  • Chain 'B':
    Compound: hemoglobin beta chain
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1y8ib_
  • Chain 'C':
    Compound: Hemoglobin alpha chains
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01958 (0-140)
      • conflict (81)
      • conflict (84)
    Domains in SCOPe 2.04: d1y8ic_
  • Chain 'D':
    Compound: hemoglobin beta chain
    Species: Equus caballus [TaxId:9796]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1y8id_
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y8iA (A:)
    vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
    kvgdaltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa
    vhasldkflssvstvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y8iB (B:)
    vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
    kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
    dftpelqasyqkvvagvanalahkyh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y8iC (C:)
    vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
    kvgdaltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa
    vhasldkflssvstvltskyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y8iD (D:)
    vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
    kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
    dftpelqasyqkvvagvanalahkyh