PDB entry 1y8i

View 1y8i on RCSB PDB site
Description: Horse methemoglobin low salt, PH 7.0 (98% relative humidity)
Class: oxygen storage/transport
Keywords: aquo methemoglobin, quarternary association, allosteric transition, protein hydration
Deposited on 2004-12-13, released 2005-07-26
The last revision prior to the SCOP 1.73 freeze date was dated 2005-07-26, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.167
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Hemoglobin alpha chains
    Species: EQUUS CABALLUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01958 (0-140)
      • conflict (81)
      • conflict (84)
    Domains in SCOP 1.73: d1y8ia1
  • Chain 'B':
    Compound: hemoglobin beta chain
    Species: EQUUS CABALLUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1y8ib1
  • Chain 'C':
    Compound: Hemoglobin alpha chains
    Species: EQUUS CABALLUS
    Gene:
    Database cross-references and differences (RAF-indexed):
    • Uniprot P01958 (0-140)
      • conflict (81)
      • conflict (84)
    Domains in SCOP 1.73: d1y8ic1
  • Chain 'D':
    Compound: hemoglobin beta chain
    Species: EQUUS CABALLUS
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1y8id1
  • Heterogens: HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y8iA (A:)
    vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
    kvgdaltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa
    vhasldkflssvstvltskyr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y8iB (B:)
    vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
    kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
    dftpelqasyqkvvagvanalahkyh
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y8iC (C:)
    vlsaadktnvkaawskvgghageygaealermflgfpttktyfphfdlshgsaqvkahgk
    kvgdaltlavghlddlpgalsdlsnlhahklrvdpvnfkllshcllstlavhlpndftpa
    vhasldkflssvstvltskyr
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1y8iD (D:)
    vqlsgeekaavlalwdkvneeevggealgrllvvypwtqrffdsfgdlsnpgavmgnpkv
    kahgkkvlhsfgegvhhldnlkgtfaalselhcdklhvdpenfrllgnvlvvvlarhfgk
    dftpelqasyqkvvagvanalahkyh