PDB entry 1y8g

View 1y8g on RCSB PDB site
Description: Catalytic and ubiqutin-associated domains of MARK2/PAR-1: Inactive double mutant with selenomethionine
Class: signaling protein,transferase
Keywords: serine/threonine protein kinase; mark; par-1; kin1; uba domain, signaling protein,transferase
Deposited on 2004-12-12, released 2006-02-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-19.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.201
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: MAP/Microtubule affinity-regulating kinase 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: MARK2
    Database cross-references and differences (RAF-indexed):
    • EMBL CAB06295
      • modified residue (66)
      • modified residue (91)
      • modified residue (109)
      • modified residue (149)
      • engineered (170)
      • engineered (174)
      • modified residue (235)
      • modified residue (261)
      • modified residue (266)
      • modified residue (294)
      • modified residue (297)
      • modified residue (317)
    Domains in SCOPe 2.07: d1y8ga_
  • Chain 'B':
    Compound: MAP/Microtubule affinity-regulating kinase 2
    Species: Rattus norvegicus [TaxId:10116]
    Gene: MARK2
    Database cross-references and differences (RAF-indexed):
    • EMBL CAB06295
      • modified residue (66)
      • modified residue (91)
      • modified residue (109)
      • modified residue (149)
      • engineered (170)
      • engineered (174)
      • modified residue (235)
      • modified residue (261)
      • modified residue (266)
      • modified residue (294)
      • modified residue (297)
      • modified residue (317)
    Domains in SCOPe 2.07: d1y8gb_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y8gA (A:)
    gnsatsadeqphignyrllktigkgnfakvklarhiltgkevavkiidktqlnssslqkl
    frevrimkvlnhpnivklfevietektlylvmeyasggevfdylvahgrmkekearakfr
    qivsavqychqkfivhrdlkaenllldadmnikiadfgfsneftfgnkldafcgappyaa
    pelfqgkkydgpevdvwslgvilytlvsgslpfdgqnlkelrervlrgkyripfymstdc
    enllkkflilnpskrgtleqimkdrwmnvgheddelkpyveplpdykdprrtelmvsmgy
    treeiqdslvgqrynevmatylllgyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y8gA (A:)
    hignyrllktigkgnfakvklarhiltgkevavkiidktqlnssslqklfrevrimkvln
    hpnivklfevietektlylvmeyasggevfdylvahgrmkekearakfrqivsavqychq
    kfivhrdlkaenllldadmnikialdafcgappyaapelfqgkkydgpevdvwslgvily
    tlvsgslpfdgqnlkelrervlrgkyripfymstdcenllkkflilnpskrgtleqimkd
    rwmnvgheddelkpyveplpdykdprrtelmvsmgytreeiqdslvgqrynevmatylll
    gy
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y8gB (B:)
    gnsatsadeqphignyrllktigkgnfakvklarhiltgkevavkiidktqlnssslqkl
    frevrimkvlnhpnivklfevietektlylvmeyasggevfdylvahgrmkekearakfr
    qivsavqychqkfivhrdlkaenllldadmnikiadfgfsneftfgnkldafcgappyaa
    pelfqgkkydgpevdvwslgvilytlvsgslpfdgqnlkelrervlrgkyripfymstdc
    enllkkflilnpskrgtleqimkdrwmnvgheddelkpyveplpdykdprrtelmvsmgy
    treeiqdslvgqrynevmatylllgyk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y8gB (B:)
    phignyrllktigkgnfakvklarhiltgkevavkiidktqlnssslqklfrevrimkvl
    nhpnivklfevietektlylvmeyasggevfdylvahgrmkekearakfrqivsavqych
    qkfivhrdlkaenllldadmnikialdafcgappyaapelfqgkkydgpevdvwslgvil
    ytlvsgslpfdgqnlkelrervlrgkyripfymstdcenllkkflilnpskrgtleqimk
    drwmnvgheddelkpyveplpdykdprrtelmvsmgytreeiqdslvgqrynevmatyll
    lg